Protein profile

PA0141

hypothetical protein

Genome: NC_002516.2

Gene: PA0141 ppk2 Structure source: AlphaFold UniProt Q9I6Z1
Amino acids 298
Annotations 5
Features 13
PDB binders 8
Druggability 0.682

Overview

Basic information about this protein and its source genome.

Accession
PA0141
Gene
PA0141 ppk2
Status
annotated
Amino acids
298
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.682
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MALQVASAPHGSSEDSTSASLPANYPYHTRMRRNEYEKAKHDLQIELLKVQSWVKETGQRVVVLFEGRDAAGKGGTIKRFMEHLNPRGARIVALEKPSSQEQGQWYFQRYIQHLPTAGEMVFFDRSWYNRAGVERVMGFCSPLQYLEFMRQAPELERMLTNSGILLFKYWFSVSREEQLRRFISRRDDPLKHWKLSPIDIKSLDKWDDYTAAKQAMFFHTDTADAPWTVIKSDDKKRARLNCIRHFLHSLDYPDKDRRIAHEPDPLLVGPASRVIEEDEKVYAEAAAAPGHANLDIPA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 4 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

4
  • GO:0008976 Catalysis of the reaction: ATP + phosphate(n) = ADP + phosphate(n+1).
  • GO:0006754 The chemical reactions and pathways resulting in the formation of ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0006183 The chemical reactions and pathways resulting in the formation of GTP, guanosine triphosphate.
  • GO:0006793 The chemical reactions and pathways involving the nonmetallic element phosphorus or compounds that contain phosphorus.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
15 264 PANTHER PTHR34383 POLYPHOSPHATE:AMP PHOSPHOTRANSFERASE-RELATED
4 278 Gene3D G3DSA:3.40.50.300 -
4 278 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
1 25 MobiDBLite mobidb-lite consensus disorder prediction
30 257 NCBIfam TIGR03707 polyphosphate kinase 2
30 257 InterPro IPR022486 Polyphosphate kinase 2, PA0141
32 257 Pfam PF03976 Polyphosphate kinase 2 (PPK2)
32 257 InterPro IPR022488 Polyphosphate kinase-2-related
62 249 SUPERFAMILY SSF52540 P-loop containing nucleoside triphosphate hydrolases
62 249 InterPro IPR027417 P-loop containing nucleoside triphosphate hydrolase
3 287 PIRSF PIRSF028756 PPK2
3 287 InterPro IPR016898 Polyphosphate phosphotransferase
9 24 MobiDBLite mobidb-lite consensus disorder prediction

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0141
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.682

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

15 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
6YW Q5NEQ5 497.9 Da LogP -0.34 TPSA 310.4 2 viol. ✓ Clean OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP…
6YX Q5NEQ5 1937.5 Da LogP 1.76 TPSA 1148.0 3 viol. ✓ Clean OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP…
6YY Q5NEQ5 897.8 Da LogP 0.24 TPSA 543.1 3 viol. ✓ Clean OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP(=O)(O)OP…
DPO M9XB82 173.9 Da LogP -3.34 TPSA 135.6 ✓ Ro5 ✓ Clean [O-]P(=O)([O-])OP(=O)([O-])[O-]
FLC A1R8G0 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O
MLI Q9HYF1 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
MLT Q92SA6 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O
PPV M9XB82 178.0 Da LogP -0.81 TPSA 124.3 ✓ Ro5 ✓ Clean OP(=O)(O)OP(=O)(O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.