Protein profile

PA0165

hypothetical protein

Genome: NC_002516.2

Gene: PA0165 Structure source: AlphaFold UniProt Q9I6W7
Export view
Amino acids 278
Annotations 1
Features 13
PDB binders 0
Druggability 0.743

Overview

Basic information about this protein and its source genome.

Accession
PA0165
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA0165
Status
annotated
Amino acids
278
Structure source
AlphaFold
GO
GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
OuterMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.743
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSRTLATVMLAGGLLAAGQAVAEDHDMTPTHETDSGPLLWHNESLTYLYGKNFKINPPIQQTFTLEHASGWTWGDLFIFFDQINYNGKEDASNGKNTYYGEITPRLSFGKLTGADLSFGPVKDVLLAGTYEFGEGDTEAYLLGPGFDLAIPGFDYFQLNFYYRKPDGNRVRAGAWQITPVWSYTIPVGNSDILIDGYMDWVINNKSASTSRRNQSDYHANLHFNPQVKYDLGKALGYEPKHLYVGLEYDYWSDKYGVKDSQYFTTDQNTASFLVKYHF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

1
  • GO:0009279 A lipid bilayer that forms the outermost membrane of the cell envelope; enriched in polysaccharide and protein; the outer leaflet of the membrane contains specific lipopolysaccharide structures.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
1 22 Phobius SIGNAL_PEPTIDE Signal peptide region
63 278 Pfam PF03502 Nucleoside-specific channel-forming protein, Tsx
63 278 InterPro IPR018013 Nucleoside-specific channel-forming protein, Tsx-like
39 278 SUPERFAMILY SSF111364 Tsx-like channel
39 278 InterPro IPR036777 Nucleoside-specific channel-forming protein, Tsx-like superfamily
38 278 Gene3D G3DSA:2.40.230.20 -
38 278 InterPro IPR036777 Nucleoside-specific channel-forming protein, Tsx-like superfamily
1 22 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
1 22 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
23 278 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
16 22 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
4 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0165
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.743
9 0.311