Overview
Basic information about this protein and its source genome.
- Accession
- PA0177
- Gene
- PA0177
- Status
- annotated
- Amino acids
- 161
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNGTEASQANGPAQEYLTFTLGREEYAIDILRVQEIRGYDQVTAIANAPPFIKGVINLRGAIVPIVDLRIKFHLAEVTYDPFTVVIILNIGRRIVGVVVDSVSDVIALGGDAIRPPPEFGASFDTEYLLGLATAGERMLILVDIERLMTSREMALVDEAAA
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
3- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0006935 The directed movement of a motile cell or organism, or the directed growth of a cell guided by a specific chemical concentration gradient. Movement may be towards a higher concentration (positive chemotaxis) or towards a lower concentration (negative chemotaxis).
- GO:0007165 The cellular process in which a signal is conveyed to trigger a change in the activity or state of a cell. Signal transduction begins with reception of a signal (e.g. a ligand binding to a receptor or receptor activation by a stimulus such as light), or for signal transduction in the absence of ligand, signal-withdrawal or the activity of a constitutively active receptor. Signal transduction ends with regulation of a downstream cellular process, e.g. regulation of transcription or regulation of a metabolic process. Signal transduction covers signaling from receptors located on the surface of the cell and signaling via molecules located within the cell. For signaling between cells, signal transduction is restricted to events at and within the receiving cell.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 14 | 152 | CDD | cd00732 | CheW |
| 11 | 148 | SMART | SM00260 | chew_2 |
| 11 | 148 | InterPro | IPR002545 | CheW-like domain |
| 17 | 142 | Gene3D | G3DSA:2.30.30.40 | SH3 Domains |
| 13 | 153 | SUPERFAMILY | SSF50341 | CheW-like |
| 13 | 153 | InterPro | IPR036061 | CheW-like domain superfamily |
| 15 | 151 | Pfam | PF01584 | CheW-like domain |
| 15 | 151 | InterPro | IPR002545 | CheW-like domain |
| 34 | 101 | FunFam | G3DSA:2.40.50.180:FF:000002 | Chemotaxis protein CheW |
| 7 | 160 | PANTHER | PTHR22617 | CHEMOTAXIS SENSOR HISTIDINE KINASE-RELATED |
| 7 | 160 | InterPro | IPR039315 | Chemotaxis protein CheW |
| 13 | 153 | ProSiteProfiles | PS50851 | CheW-like domain profile. |
| 13 | 153 | InterPro | IPR002545 | CheW-like domain |
| 34 | 143 | Gene3D | G3DSA:2.40.50.180 | - |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0177
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.74 | ||||||
| 1 | 0.63 |