Protein profile

PA0191

transcriptional regulator

Genome: NC_002516.2

Gene: PA0191 Structure source: AlphaFold UniProt Q9I6U3
Amino acids 305
Annotations 4
Features 21
PDB binders 7
Druggability 0.565

Overview

Basic information about this protein and its source genome.

Accession
PA0191
Gene
PA0191
Status
annotated
Amino acids
305
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.565
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MDLRQLRYFIALAEHRSFVRAADAMGITQPAFSRSIQGLEQELGCQLVDRGSKDLRPTPEGQVVLQHALSLVQGSANLIHEIAQLNKLDAGELRFGSGPAPAQQLVPDAVADFINRHPRVQISLDVDNWEKLSRALLREEIEFFVADIRDFEADPNFQTRPLTPRRGQFFCRPQHPLLGKDSLSTNDLFNYPLASTLIPPGIRKLLANLSGKIDFAANIRCENMHALIRIVRQTDAIGIASDETLRPYLQRGELQPLQWRNLPQNLDSLSARCGIISRSGYRLSAAAKAMIETLVELDQAQHAAA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

21 records
Show feature table
Start End DB Term Name
29 39 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
29 39 InterPro IPR000847 Transcription regulator HTH, LysR
18 29 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
18 29 InterPro IPR000847 Transcription regulator HTH, LysR
39 50 PRINTS PR00039 LysR bacterial regulatory protein HTH signature
39 50 InterPro IPR000847 Transcription regulator HTH, LysR
1 303 PANTHER PTHR30419 HTH-TYPE TRANSCRIPTIONAL REGULATOR YBHD
1 58 ProSiteProfiles PS50931 LysR-type HTH domain profile.
1 58 InterPro IPR000847 Transcription regulator HTH, LysR
89 296 Pfam PF03466 LysR substrate binding domain
89 296 InterPro IPR005119 LysR, substrate-binding
3 62 Pfam PF00126 Bacterial regulatory helix-turn-helix protein, lysR family
3 62 InterPro IPR000847 Transcription regulator HTH, LysR
93 303 Gene3D G3DSA:3.40.190.290 -
92 294 CDD cd05466 PBP2_LTTR_substrate
91 297 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
1 86 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
1 86 InterPro IPR036390 Winged helix DNA-binding domain superfamily
1 85 FunFam G3DSA:1.10.10.10:FF:000001 LysR family transcriptional regulator
1 90 Gene3D G3DSA:1.10.10.10 -
1 90 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0191
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.485
1 0.336

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

57 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
AKG P73862 146.1 Da LogP -0.50 TPSA 91.7 ✓ Ro5 ✓ Clean C(CC(=O)O)C(=O)C(=O)O
BEZ O68014 122.1 Da LogP 1.38 TPSA 37.3 ✓ Ro5 ✓ Clean c1ccc(cc1)C(=O)O
CCU P07774 142.1 Da LogP 0.27 TPSA 74.6 ✓ Ro5 ✓ Clean C(=C/C(=O)O)/C=C\C(=O)O
MLI O68014 102.0 Da LogP -3.12 TPSA 80.3 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(=O)[O-]
OAS P06614 147.1 Da LogP -1.04 TPSA 89.6 ✓ Ro5 ✓ Clean CC(=O)OC[C@@H](C(=O)O)N
SAC P06614 147.1 Da LogP -1.43 TPSA 86.6 ✓ Ro5 ✓ Clean CC(=O)N[C@@H](CO)C(=O)O
SKM Q8Y9N7 174.2 Da LogP -1.52 TPSA 98.0 ✓ Ro5 ✓ Clean C1[C@H]([C@@H]([C@@H](C=C1C(=O)O)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.