Protein profile

PA0210

malonate decarboxylase acyl carrier protein

Genome: NC_002516.2

Gene: mdcC PA0210 Structure source: AlphaFold UniProt Q9I6S8

Export view

Amino acids 99

Annotations 2

Features 6

PDB binders 0

Druggability 0.752

Overview

Basic information about this protein and its source genome.

Accession: PA0210
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: mdcC PA0210
Status: annotated
Amino acids: 99
Structure source: AlphaFold

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0000036 Binding an acyl group and presenting it for processing or offloading to a cognate enzyme. Covalently binds the acyl group via a phosphopantetheine prosthetic group and mediates protein-protein interactions with the enzyme conferring specificity. The acyl carrier protein (ACP) presents substrates to enzymes involved in fatty acid biosynthesis or in polyketide secondary metabolite biosynthesis.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.752

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

METLTFEFPAGAPARGRALAGCVGSGDLEVLLEPAAGGALSIQVVTSVNGSGPRWQQLFARVFAASTAPAASIRIHDFGATPGVVRLRLEQALEEAGHD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
GO:0000036 Binding an acyl group and presenting it for processing or offloading to a cognate enzyme. Covalently binds the acyl group via a phosphopantetheine prosthetic group and mediates protein-protein interactions with the enzyme conferring specificity. The acyl carrier protein (ACP) presents substrates to enzymes involved in fatty acid biosynthesis or in polyketide secondary metabolite biosynthesis.

Sequence Features

Domain/signature hits from InterPro and related databases.

6 records

Show feature table

Start	End	DB	Term	Name
1	99	Hamap	MF_00710	Malonate decarboxylase acyl carrier protein [mdcC].
1	99	InterPro	IPR009662	Malonate decarboxylase delta subunit
17	96	Pfam	PF06857	Malonate decarboxylase delta subunit (MdcD)
17	96	InterPro	IPR023439	Malonate decarboxylase/citrate lyase acyl carrier protein
2	95	NCBIfam	TIGR03130	malonate decarboxylase acyl carrier protein
2	95	InterPro	IPR009662	Malonate decarboxylase delta subunit

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0210	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.752