Protein profile

PA0225

transcriptional regulator

Genome: NC_002516.2

Gene: PA0225 Structure source: AlphaFold UniProt Q9I6R3
Amino acids 179
Annotations 3
Features 20
PDB binders 1
Druggability 0.658

Overview

Basic information about this protein and its source genome.

Accession
PA0225
Gene
PA0225
Status
annotated
Amino acids
179
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.658
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSMRLKLLRKKLGVTLETLAEKTGLTKSYLSKVERGLNTPSIAAALKLAKALNVQVEELFSEESDGVDGYSIVRRDQRKSLSSGDDGPAYASLAQQIGARALLPFIVHPPRDFSHSTFKEHLGEEFIFVHEGQVEVDFMNQRIILERGDALHFNAQKPHRIRSLGETQAELLVVIHSDE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
67 175 SUPERFAMILY SSF51182 RmlC-like cupins
67 175 InterPro IPR011051 RmlC-like cupin domain superfamily
4 59 SMART SM00530 mbf_short4
4 59 InterPro IPR001387 Cro/C1-type helix-turn-helix domain
5 59 Pfam PF01381 Helix-turn-helix
5 59 InterPro IPR001387 Cro/C1-type helix-turn-helix domain
5 59 ProSiteProfiles PS50943 Cro/C1-type HTH domain profile.
4 42 CDD cd00093 HTH_XRE
4 42 InterPro IPR001387 Cro/C1-type helix-turn-helix domain
1 10 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
118 174 Pfam PF07883 Cupin domain
118 174 InterPro IPR013096 Cupin 2, conserved barrel
3 66 SUPERFAMILY SSF47413 lambda repressor-like DNA-binding domains
3 66 InterPro IPR010982 Lambda repressor-like, DNA-binding domain superfamily
1 66 Gene3D G3DSA:1.10.260.40 -
1 66 InterPro IPR010982 Lambda repressor-like, DNA-binding domain superfamily
3 177 PANTHER PTHR46797 HTH-TYPE TRANSCRIPTIONAL REGULATOR
67 176 Gene3D G3DSA:2.60.120.10 Jelly Rolls
67 176 InterPro IPR014710 RmlC-like jelly roll fold
90 176 CDD cd02209 cupin_XRE_C

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0225
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.658
3 0.486
2 0.278

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

51 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
MED Q9KQN0 149.2 Da LogP 0.15 TPSA 63.3 ✓ Ro5 ✓ Clean CSCC[C@H](C(=O)O)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.