Protein profile

PA0243

transcriptional regulator

Genome: NC_002516.2

Gene: PA0243 Structure source: AlphaFold UniProt Q9I6P5

Export view

Amino acids 222

Annotations 1

Features 18

PDB binders 0

Druggability 0.624

Overview

Basic information about this protein and its source genome.

Accession: PA0243
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0243
Status: annotated
Amino acids: 222
Structure source: AlphaFold

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.624

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSKPDPAVVEESAPRGKGRKNNPEKTRQDILRAAIDEFVAQGLSGARVDAIAERTHTSKRMIYYYFGSKEQLYQAVLEKLYSDIRGIEGTLRLGALPPAKAMEKLVEFSFDYHDRHVDFVRIISIENIHKGEHIASSELVQSVNSSIVQSIAEILRRGEAEGVFRAGLEALDVHMLISSFCFYRVSNRYTVSRIFRTDLHDAEVRQRHRRMIGEAVLRYIRA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Sequence Features

Domain/signature hits from InterPro and related databases.

18 records

Show feature table

Start	End	DB	Term	Name
24	84	ProSiteProfiles	PS50977	TetR-type HTH domain profile.
24	84	InterPro	IPR001647	DNA-binding HTH domain, TetR-type
96	221	SUPERFAMILY	SSF48498	Tetracyclin repressor-like, C-terminal domain
96	221	InterPro	IPR036271	Tetracyclin repressor-like, C-terminal domain superfamily
10	221	PANTHER	PTHR30328	TRANSCRIPTIONAL REPRESSOR
10	26	MobiDBLite	mobidb-lite	consensus disorder prediction
30	43	PRINTS	PR00455	TetR bacterial regulatory protein HTH signature
30	43	InterPro	IPR001647	DNA-binding HTH domain, TetR-type
51	74	PRINTS	PR00455	TetR bacterial regulatory protein HTH signature
51	74	InterPro	IPR001647	DNA-binding HTH domain, TetR-type
1	26	MobiDBLite	mobidb-lite	consensus disorder prediction
98	216	Pfam	PF17938	Tetracyclin repressor-like, C-terminal domain
98	216	InterPro	IPR041474	HTH-type transcriptional repressor NicS, C-terminal
30	76	Pfam	PF00440	Bacterial regulatory proteins, tetR family
30	76	InterPro	IPR001647	DNA-binding HTH domain, TetR-type
17	91	SUPERFAMILY	SSF46689	Homeodomain-like
17	91	InterPro	IPR009057	Homeobox-like domain superfamily
26	222	Gene3D	G3DSA:1.10.357.10	Tetracycline Repressor, domain 2

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0243	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.624