Overview
Basic information about this protein and its source genome.
- Accession
- PA0249
- Gene
- PA0249
- Status
- annotated
- Amino acids
- 148
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSSPPKIRRYIPADRDATLAIWLEASRVGHGFLGEAELQKQKALVRDHYLDASETWLALDGDTPLGFIGLLDAFIGGLFVAPTAHGRGIGRQLVEHAATLKGALEVEVYAANREALGFYARCGFVESGRRPRDDEGRALEIVQLRREH
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0016746 Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).
- GO:0016747 Catalysis of the transfer of an acyl group, other than amino-acyl, from one compound (donor) to another (acceptor).
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 56 | 97 | CDD | cd04301 | NAT_SF |
| 1 | 145 | PANTHER | PTHR43800 | PEPTIDYL-LYSINE N-ACETYLTRANSFERASE YJAB |
| 53 | 126 | Pfam | PF13508 | Acetyltransferase (GNAT) domain |
| 53 | 126 | InterPro | IPR000182 | GNAT domain |
| 5 | 146 | ProSiteProfiles | PS51186 | Gcn5-related N-acetyltransferase (GNAT) domain profile. |
| 5 | 146 | InterPro | IPR000182 | GNAT domain |
| 6 | 147 | Gene3D | G3DSA:3.40.630.30 | - |
| 5 | 145 | SUPERFAMILY | SSF55729 | Acyl-CoA N-acyltransferases (Nat) |
| 5 | 145 | InterPro | IPR016181 | Acyl-CoA N-acyltransferase |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0249
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.7 |