Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA0283
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: sbp PA0283
Status: annotated
Amino acids: 332
Structure source: AlphaFold

GO

GO:0005615 OBSOLETE. That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid. GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall. GO:0140104 Directly binding to a specific ion or molecule and delivering it either to an acceptor molecule or to a specific location. GO:0043199 Binding to sulfate, SO4(2-), a negatively charged small molecule. GO:1902358 The directed movement of sulfate across a membrane. GO:0006790 The chemical reactions and pathways involving the nonmetallic element sulfur or compounds that contain sulfur, such as the amino acids methionine and cysteine or the tripeptide glutathione.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.709

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAFIKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADWQARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAWAWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKKEQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFYRPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Gene Ontology (GO)

7

GO:0005615 OBSOLETE. That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
GO:0140104 Directly binding to a specific ion or molecule and delivering it either to an acceptor molecule or to a specific location.
GO:0043199 Binding to sulfate, SO4(2-), a negatively charged small molecule.
GO:1902358 The directed movement of sulfate across a membrane.
GO:0006790 The chemical reactions and pathways involving the nonmetallic element sulfur or compounds that contain sulfur, such as the amino acids methionine and cysteine or the tripeptide glutathione.
GO:1901681 Binding to a sulfur compound.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records

Show feature table

Start	End	DB	Term	Name
1	22	Phobius	SIGNAL_PEPTIDE	Signal peptide region
1	22	SignalP_GRAM_POSITIVE	SignalP-TM	SignalP-TM
23	332	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
22	330	SUPERFAMILY	SSF53850	Periplasmic binding protein-like II
1	5	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
20	328	NCBIfam	TIGR00971	sulfate ABC transporter substrate-binding protein
20	328	InterPro	IPR005669	Thiosulphate/Sulfate-binding protein
39	282	Pfam	PF13531	Bacterial extracellular solute-binding protein
148	156	ProSitePatterns	PS00757	Prokaryotic sulfate-binding proteins signature 2.
148	156	InterPro	IPR034408	Sulphate/thiosulphate-binding site
1	22	SignalP_EUK	SignalP-noTM	SignalP-noTM
6	17	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
26	297	Gene3D	G3DSA:3.40.190.10	-
22	329	CDD	cd01005	PBP2_CysP
22	329	InterPro	IPR005669	Thiosulphate/Sulfate-binding protein
18	22	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
8	332	PANTHER	PTHR30368	SULFATE-BINDING PROTEIN
8	332	InterPro	IPR005669	Thiosulphate/Sulfate-binding protein
117	328	Gene3D	G3DSA:3.40.190.10	-

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0283	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.709
5				0.471

PA0283