Protein profile

PA0283

sulfate-binding protein

Genome: NC_002516.2

Gene: sbp PA0283 Structure source: AlphaFold UniProt Q9I6K7
Amino acids 332
Annotations 7
Features 19
PDB binders 0
Druggability 0.709

Overview

Basic information about this protein and its source genome.

Accession
PA0283
Gene
sbp PA0283
Status
annotated
Amino acids
332
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.709
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSLRRFALAALASALVSGPVAAATQLLNVSYDPTRELYQAYNAAFIKHWKAQGGEDLTVQQSHGGSGKQARAVIDGLKADVVTLALAGDIDELHKLGKLLPADWQARLPDNSTPYTSTIVFLVRKGNPKGIKDWGDLTKEGVEVITPNPKTSGGARWNFLAAWAWAKKQYGSDEKAKDYVQALYKHVPVLDTGARGSTITFVNNQIGDVLLAWENEAFLAKKEQGGENFEIVVPSISILAEPPVAVVDKVVEKKGTRKVAEAYLQYLYSEEGQRIAAQNFYRPRNQKVAAEFATQFPKLNLVTVDSDFGGWKTAQPKFFNDGGIFDQIYQAQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Gene Ontology (GO)

7
  • GO:0005615 OBSOLETE. That part of a multicellular organism outside the cells proper, usually taken to be outside the plasma membranes, and occupied by fluid.
  • GO:0030288 The region between the inner (cytoplasmic or plasma) membrane and outer membrane of organisms with two membranes such as Gram negative bacteria. These periplasmic spaces are relatively thick and contain a thin peptidoglycan layer (PGL), also referred to as a thin cell wall.
  • GO:0140104 Directly binding to a specific ion or molecule and delivering it either to an acceptor molecule or to a specific location.
  • GO:0043199 Binding to sulfate, SO4(2-), a negatively charged small molecule.
  • GO:1902358 The directed movement of sulfate across a membrane.
  • GO:0006790 The chemical reactions and pathways involving the nonmetallic element sulfur or compounds that contain sulfur, such as the amino acids methionine and cysteine or the tripeptide glutathione.
  • GO:1901681 Binding to a sulfur compound.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
1 22 Phobius SIGNAL_PEPTIDE Signal peptide region
1 22 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
23 332 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
22 330 SUPERFAMILY SSF53850 Periplasmic binding protein-like II
1 5 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
20 328 NCBIfam TIGR00971 sulfate ABC transporter substrate-binding protein
20 328 InterPro IPR005669 Thiosulphate/Sulfate-binding protein
39 282 Pfam PF13531 Bacterial extracellular solute-binding protein
148 156 ProSitePatterns PS00757 Prokaryotic sulfate-binding proteins signature 2.
148 156 InterPro IPR034408 Sulphate/thiosulphate-binding site
1 22 SignalP_EUK SignalP-noTM SignalP-noTM
6 17 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
26 297 Gene3D G3DSA:3.40.190.10 -
22 329 CDD cd01005 PBP2_CysP
22 329 InterPro IPR005669 Thiosulphate/Sulfate-binding protein
18 22 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
8 332 PANTHER PTHR30368 SULFATE-BINDING PROTEIN
8 332 InterPro IPR005669 Thiosulphate/Sulfate-binding protein
117 328 Gene3D G3DSA:3.40.190.10 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0283
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.709
5 0.471