Protein profile

PA0306a

transcriptional regulator

Genome: NC_002516.2

Gene: YP_008719731.1 Structure source: ColabFold
Export view
Amino acids 167
Annotations 0
Features 9
PDB binders 0
Druggability 0.721

Overview

Basic information about this protein and its source genome.

Accession
PA0306a
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
YP_008719731.1
Status
annotated
Amino acids
167
Structure source
ColabFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.721
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSLRPTLALLALVSLPLMAAQNDPQPSSKELMKEHQAQIQNDLADVDYKRKRIVEANMNLTDQEGEKFWPIYNTYRTESDKLSKETLKLLLDYAQAYNSGNVSDDQASKLIERVDDLQEDRLELRDKYVKRIAKNVSPKRAMRFLQIEIQLDAIATLEIGRQVPLVE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records
Show feature table
Start End DB Term Name
20 167 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 6 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
16 19 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
1 19 Phobius SIGNAL_PEPTIDE Signal peptide region
1 19 SignalP_GRAM_NEGATIVE SignalP-noTM SignalP-noTM
7 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 20 SignalP_EUK SignalP-noTM SignalP-noTM
1 22 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
107 127 Coils Coil Coil

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
ColabFold PA0306A
ColabFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.721
6 0.518
2 0.282