Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA0327
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0327 carP
Status: annotated
Amino acids: 321
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0055074 Any process involved in the maintenance of an internal steady state of calcium ions within an organism or cell. GO:0048870 Any process involved in the controlled self-propelled movement of a cell that results in translocation of the cell from one place to another. GO:0070301 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus. GO:0106220 The chemical reactions and pathways resulting in the formation of pyrocyanin, an iminium betaine that is 5-methylphenazin-5-ium which is substituted at position 1 by an oxidanidyl group. GO:0051592 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.651

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MTIHAQTPEPFSMSRAFTPRRLLLAVLLVALSALVLLGQSFRVFDRAWFAVQEWRHADAWKERSIWLPDYRVRIEAQPIEGLNDDVSALTFDPDRRTLFTVTNQPAQIIELSLQGKVLRTIPLTGFGDAEAIEYISRGVYVITDERQQRLVKVRLEDDTRFIDAADAQQLSLGIGLNGNKGFEGLAYDAEGKRLFVAKERDPVRIYEIHGFPHTQADKPFAVHVVDDPGRDKRLFVRDLSSLQFDEGTGHLLALSDESRLVVELDTDGEPVSTLSLLRGMHGLKRSVPQAEGVAMDDRGVLYLVSEPNLFYVFSKDEPAQP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

7 GO

Gene Ontology (GO)

7

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0055074 Any process involved in the maintenance of an internal steady state of calcium ions within an organism or cell.
GO:0048870 Any process involved in the controlled self-propelled movement of a cell that results in translocation of the cell from one place to another.
GO:0070301 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a hydrogen peroxide (H2O2) stimulus.
GO:0106220 The chemical reactions and pathways resulting in the formation of pyrocyanin, an iminium betaine that is 5-methylphenazin-5-ium which is substituted at position 1 by an oxidanidyl group.
GO:0051592 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of a calcium ion stimulus.
GO:0010040 Any process that results in a change in state or activity of a cell or an organism (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron(II) ion stimulus.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records

Show feature table

Start	End	DB	Term	Name
22	37	Phobius	SIGNAL_PEPTIDE_H_REGION	Hydrophobic region of a signal peptide.
26	316	SUPERFAMILY	SSF50956	Thermostable phytase (3-phytase)
38	42	Phobius	SIGNAL_PEPTIDE_C_REGION	C-terminal region of a signal peptide.
21	43	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
70	314	CDD	cd09971	SdiA-regulated
70	314	InterPro	IPR009722	SdiA-regulated
63	314	Pfam	PF06977	SdiA-regulated
63	314	InterPro	IPR009722	SdiA-regulated
43	321	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1	21	Phobius	SIGNAL_PEPTIDE_N_REGION	N-terminal region of a signal peptide.
57	309	Gene3D	G3DSA:2.120.10.30	-
57	309	InterPro	IPR011042	Six-bladed beta-propeller, TolB-like
1	42	Phobius	SIGNAL_PEPTIDE	Signal peptide region

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0327	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
3				0.651
2				0.243

PA0327