Overview
Basic information about this protein and its source genome.
- Accession
- PA0335
- Gene
- PA0335
- Status
- annotated
- Amino acids
- 217
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRLALFDLDNTLLAGDSDHSWGEWLCQRGLVDAAEYQARNDAFYADYVAGKLDVLAYQAFTQAILGRTEMAQLETWHRQFMQEVIEPIVLAKGEALLAEHRAAGDRLVIITATNRFVTGPIAERLGVETLIATECEMRDGRYTGQTFDVPCFQGGKVVRLQRWLDENGLDLEGASFYSDSLNDLPLLEKVSRPVAVDPDPRLRAEAEKRGWPIISLR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
3- GO:0004401 Catalysis of the reaction: L-histidinol phosphate + H2O = L-histidinol + phosphate.
- GO:0046872 Binding to a metal ion.
- GO:0000105 The chemical reactions and pathways resulting in the formation of L-histidine, 2-amino-3-(1H-imidazol-4-yl)propanoic acid.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 3 | 199 | CDD | cd02612 | HAD_PGPPase |
| 3 | 202 | NCBIfam | TIGR01490 | HAD-IB family hydrolase |
| 3 | 202 | InterPro | IPR006385 | HAD-superfamily hydrolase, subfamily IB, SerB1-like |
| 83 | 214 | FunFam | G3DSA:3.40.50.1000:FF:000025 | HAD hydrolase, family IB |
| 1 | 210 | SUPERFAMILY | SSF56784 | HAD-like |
| 1 | 210 | InterPro | IPR036412 | HAD-like superfamily |
| 3 | 214 | Gene3D | G3DSA:3.40.50.1000 | - |
| 3 | 214 | InterPro | IPR023214 | HAD superfamily |
| 2 | 215 | PANTHER | PTHR43344 | PHOSPHOSERINE PHOSPHATASE |
| 3 | 190 | NCBIfam | TIGR01488 | HAD-IB family phosphatase |
| 15 | 88 | Gene3D | G3DSA:1.20.1440.100 | - |
| 4 | 188 | Pfam | PF12710 | haloacid dehalogenase-like hydrolase |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0335
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.752 |