Protein profile

PA0342

thymidylate synthase

Genome: NC_002516.2

Gene: thyA PA0342 Structure source: AlphaFold UniProt Q9I6F1
Amino acids 264
Annotations 7
Features 28
PDB binders 29
Druggability 0.749

Overview

Basic information about this protein and its source genome.

Accession
PA0342
Gene
thyA PA0342
Status
annotated
Amino acids
264
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
51.064
Human E-value
8.309999999999999e-98
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.749
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKQYLDLMRHVREHGTFKSDRTGTGTYSVFGHQMRFDLAAGFPLVTTKKCHLKSIVHELLWFLKGSTNIAYLKEHGVSIWDEWADENGDLGPVYGYQWRSWPAPDGRHIDQIANLMAMLKKNPDSRRLIVSAWNPALIDEMALPPCHALFQFYVADGKLSCQLYQRSADIFLGVPFNIASYALLTLMVAQVAGLQPGEFIWTGGDCHLYANHLEQADLQLTREPLPLPSMKLNPEVKDLFDFRFEDFELVGYEAHPHIKAPVAV

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0004799 Catalysis of the reaction: 5,10-methylenetetrahydrofolate + dUMP = 7,8-dihydrofolate + thymidylate.
  • GO:0006231 The chemical reactions and pathways resulting in the formation of dTMP, deoxyribosylthymine monophosphate (2'-deoxyribosylthymine 5'-phosphate).
  • GO:0006235 The chemical reactions and pathways resulting in the formation of dTTP, deoxyribosylthymine triphosphate.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.
  • GO:0016741 Catalysis of the transfer of a one-carbon group from one compound (donor) to another (acceptor).

Sequence Features

Domain/signature hits from InterPro and related databases.

28 records
Show feature table
Start End DB Term Name
2 264 PANTHER PTHR11548 THYMIDYLATE SYNTHASE 1
2 264 InterPro IPR045097 Thymidylate synthase/dCMP hydroxymethylase
2 85 NCBIfam TIGR03284 thymidylate synthase
2 85 InterPro IPR000398 Thymidylate synthase
84 264 NCBIfam TIGR03284 thymidylate synthase
84 264 InterPro IPR000398 Thymidylate synthase
1 264 Hamap MF_00008 Thymidylate synthase [thyA].
1 264 InterPro IPR000398 Thymidylate synthase
42 63 PRINTS PR00108 Thymidylate synthase family signature
42 63 InterPro IPR000398 Thymidylate synthase
115 134 PRINTS PR00108 Thymidylate synthase family signature
115 134 InterPro IPR000398 Thymidylate synthase
141 156 PRINTS PR00108 Thymidylate synthase family signature
141 156 InterPro IPR000398 Thymidylate synthase
197 214 PRINTS PR00108 Thymidylate synthase family signature
197 214 InterPro IPR000398 Thymidylate synthase
159 185 PRINTS PR00108 Thymidylate synthase family signature
159 185 InterPro IPR000398 Thymidylate synthase
126 154 ProSitePatterns PS00091 Thymidylate synthase active site.
126 154 InterPro IPR020940 Thymidylate synthase, active site
2 264 Pfam PF00303 Thymidylate synthase
2 264 InterPro IPR023451 Thymidylate synthase/dCMP hydroxymethylase domain
1 264 SUPERFAMILY SSF55831 Thymidylate synthase/dCMP hydroxymethylase
1 264 InterPro IPR036926 Thymidylate synthase/dCMP hydroxymethylase superfamily
3 216 CDD cd00351 TS_Pyrimidine_HMase
3 216 InterPro IPR023451 Thymidylate synthase/dCMP hydroxymethylase domain
1 264 Gene3D G3DSA:3.30.572.10 Thymidylate synthase/dCMP hydroxymethylase domain
1 264 FunFam G3DSA:3.30.572.10:FF:000001 Thymidylate synthase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0342
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.749
9 0.233

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

145 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1JY P0A884 647.6 Da LogP 0.94 TPSA 239.3 2 viol. ✓ Clean C#CCN(c1ccc(cc1)C(=O)NC(CCC(=O)NC(CCC(=O)O)C(=O…
2BR P0A884 173.0 Da LogP 2.15 TPSA 20.2 ✓ Ro5 ✓ Clean c1ccc(c(c1)O)Br
C2F P9WFR9 459.5 Da LogP -0.26 TPSA 202.8 1 viol. ✓ Clean C[N@@]1[C@H](CNC2=C1C(=O)NC(=N2)N)CNc3ccc(cc3)C…
CB3 P0A884 477.5 Da LogP 1.19 TPSA 178.7 ✓ Ro5 ✓ Clean C#CCN(Cc1ccc2c(c1)C(=O)N=C(N2)N)c3ccc(cc3)C(=O)…
CF9 P0A886 335.3 Da LogP 3.50 TPSA 95.7 ✓ Ro5 ✓ Clean c1cc2c(ccc3c2c(c1)C(=O)O3)OC(=O)c4ccc(cc4)[N+](…
D16 P0A884 458.5 Da LogP 1.98 TPSA 152.7 ✓ Ro5 ✓ Clean CC1=NC(=O)c2cc(ccc2N1)CN(C)c3ccc(s3)C(=O)N[C@@H…
DDU P0A884 212.2 Da LogP -0.80 TPSA 84.3 ✓ Ro5 ✓ Clean C[C@@H]1[C@H](C[C@@H](O1)N2C=CC(=O)NC2=O)O
DHF P0A884 443.4 Da LogP 0.01 TPSA 211.9 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NCC2=NC3=…
DTT P0A884 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@@H]([C@H](CS)O)O)S
DTU P0A884 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@H]([C@H](CS)O)O)S
DUR P0A884 228.2 Da LogP -1.82 TPSA 104.6 ✓ Ro5 ✓ Clean C1[C@@H]([C@H](O[C@H]1N2C=CC(=O)NC2=O)CO)O
F89 P0A884 500.5 Da LogP 3.27 TPSA 152.7 1 viol. ✓ Clean CC1=Nc2ccc3ccc(cc3c2C(=O)N1)CNc4ccc5c(c4)CN(C5=…
FFO Q834R3 473.4 Da LogP -0.73 TPSA 219.8 1 viol. ✓ Clean c1cc(ccc1C(=O)NC(CCC(=O)O)C(=O)O)NCC2CNC3=C(N2C…
GA9 P0A884 560.6 Da LogP 6.89 TPSA 66.8 2 viol. ✓ Clean c1cc2c(ccc3c2c(c1)C(OC3=O)(c4ccc(c(c4)Br)O)c5cc…
LY3 P0A884 451.4 Da LogP -0.05 TPSA 208.4 1 viol. ✓ Clean c1cc(ccc1CCc2c[nH]c3c2C(=O)NC(=N3)N)C(=O)N[C@@H…
LYA P9WFR9 427.4 Da LogP 0.67 TPSA 191.3 1 viol. ✓ Clean c1cc(ccc1CCc2c[nH]c3c2C(=O)N=C(N3)N)C(=O)N[C@@H…
LYB P0A884 814.8 Da LogP -1.28 TPSA 390.5 3 viol. ✓ Clean c1cc(ccc1CCc2c[nH]c3c2C(=O)NC(=N3)N)C(=O)N[C@@H…
LYD P0A884 397.4 Da LogP 1.46 TPSA 154.0 ✓ Ro5 ✓ Clean CC(C)[C@@H](C(=O)O)NC(=O)c1ccc(cc1)CCc2c[nH]c3c…
MEF P0A884 457.4 Da LogP -0.52 TPSA 194.0 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)[N@]2C[C@…
MTX Q834R3 454.4 Da LogP 0.27 TPSA 210.5 ✓ Ro5 ✓ Clean CN(Cc1cnc2c(n1)c(nc(n2)N)N)c3ccc(cc3)C(=O)N[C@@…
NDN P0A884 353.2 Da LogP -1.80 TPSA 194.2 ✓ Ro5 ✓ Clean C1[C@@H]([C@H](O[C@H]1N2C=C(C(=O)NC2=O)[N+](=O)…
NDU P0A884 355.2 Da LogP -2.23 TPSA 188.8 ✓ Ro5 ✓ Clean C1[C@@H]([C@H](O[C@H]1N2CC(C(=O)NC2=O)[N+](=O)[…
PFG P0A884 864.8 Da LogP -0.76 TPSA 377.9 3 viol. ✓ Clean C#CCN(Cc1ccc2c(c1)C(=O)N=C(N2)N)c3ccc(cc3)C(=O)…
SPM P9WFR9 202.3 Da LogP -0.36 TPSA 76.1 ✓ Ro5 ✓ Clean C(CCNCCCN)CNCCCN
SS7 Q834R3 367.4 Da LogP 3.29 TPSA 72.9 ✓ Ro5 ✓ Clean Cc1cc(cc(c1OC[C@H](C)N2C(=O)c3ccccc3C2=O)C)OC(=…
THG P0A884 445.4 Da LogP -0.28 TPSA 211.6 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC[C@H]2C…
TP2 P0A884 328.5 Da LogP 1.19 TPSA 66.5 ✓ Ro5 ✓ Clean Cc1ccc(cc1)S(=O)(=O)[N@]2CCC[C@@H]2C(=O)NCCS
TPR P0A884 269.3 Da LogP 1.23 TPSA 74.7 ✓ Ro5 ✓ Clean Cc1ccc(cc1)S(=O)(=O)[N@]2CCC[C@@H]2C(=O)O
UMC P0A884 310.2 Da LogP -1.49 TPSA 145.6 ✓ Ro5 ✓ Clean C1CN(C(=O)NC1=O)[C@H]2C[C@@H]([C@H](O2)COP(=O)(…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.