Protein profile

PA0350

dihydrofolate reductase

Genome: NC_002516.2

Gene: folA PA0350 Structure source: AlphaFold UniProt Q9I6E3
Amino acids 168
Annotations 10
Features 20
PDB binders 13
Druggability 0.736

Overview

Basic information about this protein and its source genome.

Accession
PA0350
Gene
folA PA0350
Status
annotated
Amino acids
168
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
40.741
Human E-value
4.7e-09
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.736
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MARPLAMIAALGENRAIGIDNRLPWRLPADLKHFKAMTLGKPVIMGRKTWDSLGRPLPGRLNLVVSRQAGLALEGAEVFASLDAALARAEAWAQAEDADELMLIGGAQLYAEALPRAARLYLTRVGLAPEGDAFFPEIDGAAWRLASSIEHAAADDAPAYAFEVWERR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 9 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

9
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0004146 Catalysis of the reaction: 5,6,7,8-tetrahydrofolate + NADP+ = 7,8-dihydrofolate + NADPH + H+.
  • GO:0050661 Binding to nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions; binding may be to either the oxidized form, NADP+, or the reduced form, NADPH.
  • GO:0070401 Binding to the oxidized form, NADP+, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
  • GO:0046452 The chemical reactions and pathways involving dihydrofolate, the dihydroxylated derivative of folate.
  • GO:0046655 The chemical reactions and pathways involving folic acid, pteroylglutamic acid. Folic acid is widely distributed as a member of the vitamin B complex and is essential for the synthesis of purine and pyrimidines.
  • GO:0006730 The chemical reactions and pathways involving the transfer of one-carbon units in various oxidation states.
  • GO:0046654 The chemical reactions and pathways resulting in the formation of tetrahydrofolate, 5,6,7,8-tetrahydrofolic acid, a folate derivative bearing additional hydrogens on the pterin group.
  • GO:0006545 The chemical reactions and pathways resulting in the formation of glycine, aminoethanoic acid.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
3 168 FunFam G3DSA:3.40.430.10:FF:000001 Dihydrofolate reductase
4 168 Gene3D G3DSA:3.40.430.10 Dihydrofolate Reductase, subunit A
4 168 InterPro IPR024072 Dihydrofolate reductase-like domain superfamily
5 166 PANTHER PTHR48069 DIHYDROFOLATE REDUCTASE
5 166 InterPro IPR012259 Dihydrofolate reductase
16 38 ProSitePatterns PS00075 Dihydrofolate reductase (DHFR) domain signature.
16 38 InterPro IPR017925 Dihydrofolate reductase conserved site
100 114 PRINTS PR00070 Dihydrofolate reductase signature
30 38 PRINTS PR00070 Dihydrofolate reductase signature
16 26 PRINTS PR00070 Dihydrofolate reductase signature
43 54 PRINTS PR00070 Dihydrofolate reductase signature
4 168 SUPERFAMILY SSF53597 Dihydrofolate reductase-like
5 151 CDD cd00209 DHFR
5 151 InterPro IPR001796 Dihydrofolate reductase domain
1 168 PIRSF PIRSF000194 DHFR
1 168 InterPro IPR012259 Dihydrofolate reductase
4 167 ProSiteProfiles PS51330 Dihydrofolate reductase (DHFR) domain profile.
4 167 InterPro IPR001796 Dihydrofolate reductase domain
5 167 Pfam PF00186 Dihydrofolate reductase
5 167 InterPro IPR001796 Dihydrofolate reductase domain

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0350
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.736

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

163 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
31I Q81R22 486.6 Da LogP 3.84 TPSA 129.0 ✓ Ro5 ✓ Clean CC(C)[C@H]1c2ccccc2C=NN1C(=O)/C=C/c3cc(cc(c3OC)…
34R Q81R22 520.6 Da LogP 4.23 TPSA 129.0 1 viol. ✓ Clean COc1cc(cc(c1OC)/C=C/C(=O)N2[C@@H](c3ccccc3C=N2)…
34S Q81R22 520.6 Da LogP 4.23 TPSA 129.0 1 viol. ✓ Clean COc1cc(cc(c1OC)/C=C/C(=O)N2[C@H](c3ccccc3C=N2)c…
35I Q81R22 540.5 Da LogP 4.52 TPSA 129.0 1 viol. ✓ Clean COc1cc(cc(c1OC)/C=C/C(=O)N2[C@H](c3ccccc3C=N2)C…
52I Q81R22 500.6 Da LogP 4.23 TPSA 129.0 1 viol. ✓ Clean CC(C)C[C@@H]1c2ccccc2C=NN1C(=O)/C=C/c3cc(cc(c3O…
52J Q81R22 500.6 Da LogP 4.23 TPSA 129.0 1 viol. ✓ Clean CC(C)C[C@H]1c2ccccc2C=NN1C(=O)/C=C/c3cc(cc(c3OC…
53I Q81R22 498.6 Da LogP 4.15 TPSA 129.0 ✓ Ro5 ✓ Clean CC(=C[C@@H]1c2ccccc2C=NN1C(=O)/C=C/c3cc(cc(c3OC…
53J Q81R22 498.6 Da LogP 4.15 TPSA 129.0 ✓ Ro5 ✓ Clean CC(=C[C@H]1c2ccccc2C=NN1C(=O)/C=C/c3cc(cc(c3OC)…
5WB Q81R22 358.4 Da LogP 1.71 TPSA 114.7 ✓ Ro5 ✓ Clean Cc1c(c(nc(n1)N)N)C#CC(c2cc(c(c(c2)OC)OC)OC)OC
6DR Q81R22 359.4 Da LogP 2.87 TPSA 99.9 ✓ Ro5 ✓ Clean CCc1c(c(nc(n1)N)N)C#CCc2cc(ccc2OC)c3ccncc3
9DR Q81R22 359.4 Da LogP 2.87 TPSA 99.9 ✓ Ro5 ✓ Clean CCc1c(c(nc(n1)N)N)C#CCc2cc(cc(c2)OC)c3ccncc3
FOL Q83AB2 441.4 Da LogP -0.04 TPSA 213.3 1 viol. ✓ Clean c1cc(ccc1C(=O)N[C@@H](CCC(=O)O)C(=O)O)NCc2cnc3c…
TOP Q83AB2 290.3 Da LogP 1.26 TPSA 105.5 ✓ Ro5 ✓ Clean COc1cc(cc(c1OC)OC)Cc2cnc(nc2N)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.