Overview
Basic information about this protein and its source genome.
- Accession
- PA0416
- Gene
- chpD PA0416 GNQ48_07835
- Status
- annotated
- Amino acids
- 264
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MAGLQHARIGASLEVASASLAGHRFEKHSHDEFVISANLCGLEDVWLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELASSLDLSSVEFDRPLLRSPALGRELAASIEALLASDRFARERGEERLLEFLGRLLAASGTRLPQRADPGRPAVARLQALLAERLAEPPDLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLLRRGLAVGEVAHALGFADQSHLTRYFTSAYGISPGRYQRAVRG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
- GO:0000987 Binding to a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site, located in cis relative to the transcription start site (i.e., on the same strand of DNA) of a gene transcribed by some RNA polymerase. Cis-regulatory sites are often referred to as a sequence motifs, enhancers, or silencers.
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0009893 Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways within a cell or an organism.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 177 | 259 | SMART | SM00342 | aracneu4 |
| 177 | 259 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 21 | 144 | SUPERFAMILY | SSF51215 | Regulatory protein AraC |
| 21 | 144 | InterPro | IPR037923 | Transcription regulator HTH-like |
| 164 | 261 | ProSiteProfiles | PS01124 | Bacterial regulatory proteins, araC family DNA-binding domain profile. |
| 164 | 261 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 161 | 211 | SUPERFAMILY | SSF46689 | Homeodomain-like |
| 161 | 211 | InterPro | IPR009057 | Homeobox-like domain superfamily |
| 167 | 206 | ProSitePatterns | PS00041 | Bacterial regulatory proteins, araC family signature. |
| 167 | 206 | InterPro | IPR018062 | HTH domain AraC-type, conserved site |
| 12 | 141 | Pfam | PF02311 | AraC-like ligand binding domain |
| 12 | 141 | InterPro | IPR003313 | AraC-type arabinose-binding/dimerisation domain |
| 216 | 264 | Gene3D | G3DSA:1.10.10.60 | - |
| 161 | 215 | Gene3D | G3DSA:1.10.10.60 | - |
| 183 | 260 | Pfam | PF12833 | Helix-turn-helix domain |
| 183 | 260 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 11 | 263 | PANTHER | PTHR46796 | HTH-TYPE TRANSCRIPTIONAL ACTIVATOR RHAS-RELATED |
| 213 | 261 | SUPERFAMILY | SSF46689 | Homeodomain-like |
| 213 | 261 | InterPro | IPR009057 | Homeobox-like domain superfamily |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0416
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.676 | ||||||
| 3 | 0.49 | ||||||
| 2 | 0.215 |