Protein profile

PA0416

transcriptional regulator

Genome: NC_002516.2

Gene: chpD PA0416 GNQ48_07835 Structure source: AlphaFold UniProt O87004 UniProt G3XCU1
Amino acids 264
Annotations 6
Features 19
PDB binders 0
Druggability 0.676

Overview

Basic information about this protein and its source genome.

Accession
PA0416
Gene
chpD PA0416 GNQ48_07835
Status
annotated
Amino acids
264
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.676
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MAGLQHARIGASLEVASASLAGHRFEKHSHDEFVISANLCGLEDVWLDGRTFQADSGDLTLYNPGQIQGGGVRDGQPWRFASLYLPAAELASSLDLSSVEFDRPLLRSPALGRELAASIEALLASDRFARERGEERLLEFLGRLLAASGTRLPQRADPGRPAVARLQALLAERLAEPPDLDGMAEQVGLSKYHLLRAFKKATGLSPRQWSMQLRTRRALGLLRRGLAVGEVAHALGFADQSHLTRYFTSAYGISPGRYQRAVRG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0000987 Binding to a specific upstream regulatory DNA sequence (transcription factor recognition sequence or binding site, located in cis relative to the transcription start site (i.e., on the same strand of DNA) of a gene transcribed by some RNA polymerase. Cis-regulatory sites are often referred to as a sequence motifs, enhancers, or silencers.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0009893 Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways within a cell or an organism.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records
Show feature table
Start End DB Term Name
177 259 SMART SM00342 aracneu4
177 259 InterPro IPR018060 DNA binding HTH domain, AraC-type
21 144 SUPERFAMILY SSF51215 Regulatory protein AraC
21 144 InterPro IPR037923 Transcription regulator HTH-like
164 261 ProSiteProfiles PS01124 Bacterial regulatory proteins, araC family DNA-binding domain profile.
164 261 InterPro IPR018060 DNA binding HTH domain, AraC-type
161 211 SUPERFAMILY SSF46689 Homeodomain-like
161 211 InterPro IPR009057 Homeobox-like domain superfamily
167 206 ProSitePatterns PS00041 Bacterial regulatory proteins, araC family signature.
167 206 InterPro IPR018062 HTH domain AraC-type, conserved site
12 141 Pfam PF02311 AraC-like ligand binding domain
12 141 InterPro IPR003313 AraC-type arabinose-binding/dimerisation domain
216 264 Gene3D G3DSA:1.10.10.60 -
161 215 Gene3D G3DSA:1.10.10.60 -
183 260 Pfam PF12833 Helix-turn-helix domain
183 260 InterPro IPR018060 DNA binding HTH domain, AraC-type
11 263 PANTHER PTHR46796 HTH-TYPE TRANSCRIPTIONAL ACTIVATOR RHAS-RELATED
213 261 SUPERFAMILY SSF46689 Homeodomain-like
213 261 InterPro IPR009057 Homeobox-like domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0416
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.676
3 0.49
2 0.215