Protein profile

PA0461

acyltransferase

Genome: NC_002516.2

Gene: PA0461 Structure source: AlphaFold UniProt Q9I657

Export view

Amino acids 295

Annotations 1

Features 13

PDB binders 1

Druggability 0.769

Overview

Basic information about this protein and its source genome.

Accession: PA0461
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0461
Status: annotated
Amino acids: 295
Structure source: AlphaFold

GO:0016746 Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).

Target profile

Computed evidence for target prioritization.

Human off-target: hit
Human identity (%): 27.928
Human E-value: 6.94e-12
Gut microbiome off-target: hit
Essential (DEG): N
Localization: CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.769

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MRELLTGLTSSLLLLLNTLILIGPMMLIALLKLVLPGQRLKDLCSRGVMWIAETWAEIDKWIFATCTPTVWDVRGASDLRQDTSYLVVSNHQSWVDIPALIQVFNRRTPYFKFFLKKELIWVPFLGLAWWALEYPFMKRYSKAFLEKHPELKGKDLEITKAACEKFKRIPVTVVNYLEGTRFSEQKKARQQSPYRHLLKPKAGGVAFVLAALGEQLDALLDVTVVYPSDKVPGFWDLLCGRVPKVIVDIQTRPIDPALWQGDYENDPVFRQYVQEWVSRMWEEKDERIARLRQLR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0016746 Catalysis of the transfer of an acyl group from one compound (donor) to another (acceptor).

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records

Show feature table

Start	End	DB	Term	Name
13	290	PANTHER	PTHR10983	1-ACYLGLYCEROL-3-PHOSPHATE ACYLTRANSFERASE-RELATED
7	29	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
12	35	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
138	295	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
73	226	Pfam	PF01553	Acyltransferase
73	226	InterPro	IPR002123	Phospholipid/glycerol acyltransferase
119	137	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
61	246	CDD	cd07990	LPLAT_LCLAT1-like
36	118	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
8	293	SUPERFAMILY	SSF69593	Glycerol-3-phosphate (1)-acyltransferase
1	11	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
85	227	SMART	SM00563	plsc_2
85	227	InterPro	IPR002123	Phospholipid/glycerol acyltransferase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0461	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
3				0.769
1				0.27

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

47 records

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
DD9	5KYM	Q9X219	128.3 Da LogP 3.76 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCC`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC1545440	0.615	213.4 Da LogP 4.65 TPSA 26.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCN`
ZINC1644076	0.615	214.4 Da LogP 4.68 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCO`
ZINC1680803	0.615	200.4 Da LogP 4.29 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCO`
ZINC195766643	0.615	231.9 Da LogP 2.93 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCC[Sn+3]`
ZINC59144932	0.615	202.4 Da LogP 4.84 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCCS`
ZINC100027350	0.571	227.4 Da LogP 4.91 TPSA 12.0	✓ Ro5	✓ Clean	`CCCCCCCCNCCCCCCC`
ZINC1627284	0.571	214.4 Da LogP 4.94 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCOCCCCCCC`
ZINC1699899	0.571	202.4 Da LogP 4.88 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCSCCCCCC`
ZINC1724011	0.571	213.4 Da LogP 4.52 TPSA 12.0	✓ Ro5	✓ Clean	`CCCCCCCNCCCCCCC`
ZINC2564179	0.571	214.4 Da LogP 4.94 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCCOCCCCCC`
ZINC100050955	0.533	327.6 Da LogP 4.48 TPSA 36.1	✓ Ro5	✓ Clean	`CCCCCCCCNCCNCCNCCCCCCCC`
ZINC100077022	0.533	227.4 Da LogP 4.86 TPSA 3.2	✓ Ro5	✓ Clean	`CCCCCCCN(C)CCCCCCC`
ZINC100924963	0.533	284.5 Da LogP 4.89 TPSA 24.1	✓ Ro5	✓ Clean	`CCCCCCCCNCCNCCCCCCCC`
ZINC106401282	0.533	227.4 Da LogP 4.91 TPSA 12.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCCNC`
ZINC1673414	0.533	228.4 Da LogP 4.61 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCC[N+](C)(C)C`
ZINC1687260	0.533	213.4 Da LogP 4.47 TPSA 3.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCN(C)C`
ZINC1700269	0.533	200.4 Da LogP 3.83 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCCC[N+](C)(C)C`
ZINC2555244	0.533	227.4 Da LogP 4.86 TPSA 3.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCN(C)C`
ZINC35052519	0.533	228.4 Da LogP 3.33 TPSA 24.1	✓ Ro5	✓ Clean	`CCCCCCNCCNCCCCCC`
ZINC59359855	0.533	231.5 Da LogP 4.79 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCC[S+](C)C`
ZINC100015910	0.500	214.4 Da LogP 4.68 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCC[C@@H](O)CCCCCC`
ZINC114881475	0.500	206.4 Da LogP 4.31 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCCC(S)S`
ZINC1593347	0.500	246.5 Da LogP 4.68 TPSA 17.1	✓ Ro5	✓ Clean	`CCCCCCCS(=O)CCCCCCC`
ZINC1599570	0.500	227.4 Da LogP 4.86 TPSA 3.2	✓ Ro5	✓ Clean	`CCCCCN(CCCCC)CCCCC`
ZINC1605994	0.500	202.4 Da LogP 4.88 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCCCSCC`
ZINC1606032	0.500	200.4 Da LogP 4.29 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCC[C@@H](O)CCCCC`
ZINC1606040	0.500	214.4 Da LogP 4.68 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCCC[C@@H](O)CCCCC`
ZINC1606049	0.500	200.4 Da LogP 4.29 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCC(O)CCCCCC`
ZINC1672455	0.500	226.4 Da LogP 4.07 TPSA 34.1	✓ Ro5	Alert	`CCCCCCC(=O)C(=O)CCCCCC`
ZINC1687262	0.500	213.4 Da LogP 4.52 TPSA 12.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCCNCC`
ZINC1693894	0.500	212.4 Da LogP 4.89 TPSA 17.1	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCC=O`
ZINC1697133	0.500	214.4 Da LogP 4.94 TPSA 9.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCOCC`
ZINC169808442	0.500	305.1 Da LogP 4.57 TPSA 17.1	✓ Ro5	✓ Clean	`CCCCCC[Sn](=O)CCCCCC`
ZINC196468891	0.500	261.0 Da LogP 3.91 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCC[Sn+2]CCCCC`
ZINC20231719	0.500	234.4 Da LogP 3.56 TPSA 34.1	✓ Ro5	✓ Clean	`CCCCCCS(=O)(=O)CCCCCC`
ZINC2166283	0.500	262.5 Da LogP 4.34 TPSA 34.1	✓ Ro5	✓ Clean	`CCCCCCCCS(=O)(=O)CCCCCC`
ZINC221753674	0.500	324.3 Da LogP 4.61 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCC[Sn](Cl)(Cl)Cl`
ZINC2508105	0.500	200.4 Da LogP 4.29 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCC[C@H](O)CCCCC`
ZINC2509968	0.500	214.4 Da LogP 4.68 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCC[C@H](O)CCCCCC`
ZINC2528299	0.500	214.4 Da LogP 4.68 TPSA 20.2	✓ Ro5	✓ Clean	`CCCCCCCC[C@H](O)CCCCC`
ZINC2900787	0.500	228.4 Da LogP 4.61 TPSA 0.0	✓ Ro5	✓ Clean	`CCCCCCCCC[N+](CC)(CC)CC`
ZINC45331803	0.500	201.4 Da LogP 3.80 TPSA 35.2	✓ Ro5	✓ Clean	`CCCCCCCCCCCCON`
ZINC59631801	0.500	200.4 Da LogP 3.37 TPSA 38.0	✓ Ro5	✓ Clean	`CCCCCCCCCCCCNN`
ZINC60107866	0.500	242.5 Da LogP 4.41 TPSA 24.1	✓ Ro5	✓ Clean	`CCCCCCCCCCCCNNCCC`
ZINC71773056	0.500	200.4 Da LogP 3.32 TPSA 29.3	✓ Ro5	✓ Clean	`CCCCCCN(N)CCCCCC`
ZINC97973035	0.500	212.4 Da LogP 4.23 TPSA 49.9	✓ Ro5	✓ Clean	`CCCCCCCCCCCCC(=N)N`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.