Overview
Basic information about this protein and its source genome.
- Accession
- PA0472
- Gene
- PA0472
- Status
- annotated
- Amino acids
- 172
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MSAGDVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTFVRLLGRPELPGLREPRAFLAKVARGLMIDHFRRAALEQAYLAELALVPEAEQPSAEEQYLILEDLREIDRLLGTLSLKARSAFLYSRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQCYIALYGEPR
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
6- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0016987 Sigma factors act as the promoter specificity subunit of eubacterial and plant plastid multisubunit RNA polymerases, whose core subunit composition is often described as alpha(2)-beta-beta-prime. Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, the sigma factor binds specifically to promoter elements. The sigma subunit is released once elongation begins.
- GO:0006352 The initial step of transcription, consisting of the assembly of the RNA polymerase preinitiation complex (PIC) at a gene promoter, as well as the formation of the first few bonds of the RNA transcript. Transcription initiation includes abortive initiation events, which occur when the first few nucleotides are repeatedly synthesized and then released, and ends when promoter clearance takes place.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
- GO:0034756 Any process that modulates the frequency, rate or extent of the directed movement of iron ions (Fe) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 92 | 167 | Gene3D | G3DSA:1.10.10.10 | - |
| 92 | 167 | InterPro | IPR036388 | Winged helix-like DNA-binding domain superfamily |
| 111 | 163 | Pfam | PF08281 | Sigma-70, region 4 |
| 111 | 163 | InterPro | IPR013249 | RNA polymerase sigma factor 70, region 4 type 2 |
| 89 | 167 | SUPERFAMILY | SSF88659 | Sigma3 and sigma4 domains of RNA polymerase sigma factors |
| 89 | 167 | InterPro | IPR013324 | RNA polymerase sigma factor, region 3/4-like |
| 15 | 79 | Pfam | PF04542 | Sigma-70 region 2 |
| 15 | 79 | InterPro | IPR007627 | RNA polymerase sigma-70 region 2 |
| 12 | 163 | PANTHER | PTHR43133 | RNA POLYMERASE ECF-TYPE SIGMA FACTO |
| 12 | 163 | InterPro | IPR039425 | RNA polymerase sigma-70 like |
| 8 | 77 | SUPERFAMILY | SSF88946 | Sigma2 domain of RNA polymerase sigma factors |
| 8 | 77 | InterPro | IPR013325 | RNA polymerase sigma factor, region 2 |
| 2 | 79 | Gene3D | G3DSA:1.10.1740.10 | - |
| 15 | 163 | NCBIfam | TIGR02937 | sigma-70 family RNA polymerase sigma factor |
| 15 | 163 | InterPro | IPR014284 | RNA polymerase sigma-70 like domain |
| 78 | 167 | FunFam | G3DSA:1.10.10.10:FF:000427 | RNA polymerase sigma factor |
| 4 | 92 | FunFam | G3DSA:1.10.1740.10:FF:000009 | RNA polymerase sigma factor |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0472
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.73 |