Protein profile

PA0472

RNA polymerase sigma factor

Genome: NC_002516.2

Gene: PA0472 Structure source: AlphaFold UniProt Q9I646
Amino acids 172
Annotations 6
Features 17
PDB binders 0
Druggability 0.73

Overview

Basic information about this protein and its source genome.

Accession
PA0472
Gene
PA0472
Status
annotated
Amino acids
172
Structure source
AlphaFold
GO
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0016987 Sigma factors act as the promoter specificity subunit of eubacterial and plant plastid multisubunit RNA polymerases, whose core subunit composition is often described as alpha(2)-beta-beta-prime. Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, the sigma factor binds specifically to promoter elements. The sigma subunit is released once elongation begins. GO:0006352 The initial step of transcription, consisting of the assembly of the RNA polymerase preinitiation complex (PIC) at a gene promoter, as well as the formation of the first few bonds of the RNA transcript. Transcription initiation includes abortive initiation events, which occur when the first few nucleotides are repeatedly synthesized and then released, and ends when promoter clearance takes place. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription. GO:0034756 Any process that modulates the frequency, rate or extent of the directed movement of iron ions (Fe) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore. GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.73
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSAGDVSNSEFVGSLYRDHRGWLLAWLNRNLGCRQRAEDLSQDTFVRLLGRPELPGLREPRAFLAKVARGLMIDHFRRAALEQAYLAELALVPEAEQPSAEEQYLILEDLREIDRLLGTLSLKARSAFLYSRLDGMPHAEIAERLGVSVPRVRQYLAQGLRQCYIALYGEPR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

6 GO

Gene Ontology (GO)

6
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0016987 Sigma factors act as the promoter specificity subunit of eubacterial and plant plastid multisubunit RNA polymerases, whose core subunit composition is often described as alpha(2)-beta-beta-prime. Although sigma does not bind DNA on its own, when combined with the core to form the holoenzyme, the sigma factor binds specifically to promoter elements. The sigma subunit is released once elongation begins.
  • GO:0006352 The initial step of transcription, consisting of the assembly of the RNA polymerase preinitiation complex (PIC) at a gene promoter, as well as the formation of the first few bonds of the RNA transcript. Transcription initiation includes abortive initiation events, which occur when the first few nucleotides are repeatedly synthesized and then released, and ends when promoter clearance takes place.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0034756 Any process that modulates the frequency, rate or extent of the directed movement of iron ions (Fe) into, out of or within a cell, or between cells, by means of some agent such as a transporter or pore.
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records
Show feature table
Start End DB Term Name
92 167 Gene3D G3DSA:1.10.10.10 -
92 167 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
111 163 Pfam PF08281 Sigma-70, region 4
111 163 InterPro IPR013249 RNA polymerase sigma factor 70, region 4 type 2
89 167 SUPERFAMILY SSF88659 Sigma3 and sigma4 domains of RNA polymerase sigma factors
89 167 InterPro IPR013324 RNA polymerase sigma factor, region 3/4-like
15 79 Pfam PF04542 Sigma-70 region 2
15 79 InterPro IPR007627 RNA polymerase sigma-70 region 2
12 163 PANTHER PTHR43133 RNA POLYMERASE ECF-TYPE SIGMA FACTO
12 163 InterPro IPR039425 RNA polymerase sigma-70 like
8 77 SUPERFAMILY SSF88946 Sigma2 domain of RNA polymerase sigma factors
8 77 InterPro IPR013325 RNA polymerase sigma factor, region 2
2 79 Gene3D G3DSA:1.10.1740.10 -
15 163 NCBIfam TIGR02937 sigma-70 family RNA polymerase sigma factor
15 163 InterPro IPR014284 RNA polymerase sigma-70 like domain
78 167 FunFam G3DSA:1.10.10.10:FF:000427 RNA polymerase sigma factor
4 92 FunFam G3DSA:1.10.1740.10:FF:000009 RNA polymerase sigma factor

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0472
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.73