Protein profile

PA0493

acetyl-CoA carboxylase biotin carboxyl carrier protein subunit

Genome: NC_002516.2

Gene: PA0493 Structure source: AlphaFold UniProt Q9I625

Export view

Amino acids 82

Annotations 3

Features 14

PDB binders 0

Druggability 0.669

Overview

Basic information about this protein and its source genome.

Accession: PA0493
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0493
Status: annotated
Amino acids: 82
Structure source: AlphaFold

GO:0009317 A protein complex that catalyzes the first step in long-chain fatty acid biosynthesis. For example, in E. coli the complex is heterohexameric and composed of biotin carbonyl carrier protein, biotin carboxylase and the acetate CoA-transferase complex. GO:0003989 Catalysis of the reaction: ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA. GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.669

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MAEHNVQSPLPGTFYRKASPDAPPYAEVGQAVEAGSVIGLIEVMKQFSEVQAGQAGILQAFHVEDGEAIEPGQVLAVIASAT

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

GO:0009317 A protein complex that catalyzes the first step in long-chain fatty acid biosynthesis. For example, in E. coli the complex is heterohexameric and composed of biotin carbonyl carrier protein, biotin carboxylase and the acetate CoA-transferase complex.
GO:0003989 Catalysis of the reaction: ATP + acetyl-CoA + HCO3- = ADP + phosphate + malonyl-CoA.
GO:0006633 The chemical reactions and pathways resulting in the formation of a fatty acid, any of the aliphatic monocarboxylic acids that can be liberated by hydrolysis from naturally occurring fats and oils. Fatty acids are predominantly straight-chain acids of 4 to 24 carbon atoms, which may be saturated or unsaturated; branched fatty acids and hydroxy fatty acids also occur, and very long chain acids of over 30 carbons are found in waxes.

Sequence Features

Domain/signature hits from InterPro and related databases.

14 records

Show feature table

Start	End	DB	Term	Name
5	78	SUPERFAMILY	SSF51230	Single hybrid motif
5	78	InterPro	IPR011053	Single hybrid motif
40	53	PRINTS	PR01071	Acetyl-CoA biotin carboxyl carrier protein signature
40	53	InterPro	IPR001249	Acetyl-CoA biotin carboxyl carrier
8	21	PRINTS	PR01071	Acetyl-CoA biotin carboxyl carrier protein signature
8	21	InterPro	IPR001249	Acetyl-CoA biotin carboxyl carrier
25	39	PRINTS	PR01071	Acetyl-CoA biotin carboxyl carrier protein signature
25	39	InterPro	IPR001249	Acetyl-CoA biotin carboxyl carrier
1	79	ProSiteProfiles	PS50968	Biotinyl/lipoyl domain profile.
1	79	InterPro	IPR000089	Biotin/lipoyl attachment
5	78	Pfam	PF00364	Biotin-requiring enzyme
5	78	InterPro	IPR000089	Biotin/lipoyl attachment
6	78	CDD	cd06850	biotinyl_domain
1	78	Gene3D	G3DSA:2.40.50.100	-

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0493	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.669