Protein profile

PA0517

cytochrome c55X

Genome: NC_002516.2

Gene: PA0517 nirC Structure source: Experimental + AlphaFold UniProt Q51479
Export view
Amino acids 119
Annotations 4
Features 14
PDB binders 0
Druggability 0.674

Overview

Basic information about this protein and its source genome.

Accession
PA0517
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA0517 nirC
Status
annotated
Amino acids
119
Structure source
Experimental + AlphaFold
GO
GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria). GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways. GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring. GO:0046872 Binding to a metal ion.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.674
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MNAPPDFRRAASHALWLALALTFACPLPGLADEHPDARRQAQLRHLLLQDCGSCHGLRLTGGLGPALTPEALRGKPRESLVATVLMGRPQTPMPPWAGLLSEDDAGWLVDRLIEGEIAP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0009055 A molecular function representing the directed movement of electrons from one molecular entity to another, typically mediated by electron carriers or acceptors, resulting in the transfer of energy and/or the reduction-oxidation (redox) transformation of chemical species. This activity is fundamental to various biological processes, including cellular respiration and photosynthesis, as well as numerous enzymatic reactions involved in metabolic pathways.
  • GO:0020037 Binding to a heme, a compound composed of iron complexed in a porphyrin (tetrapyrrole) ring.
  • GO:0046872 Binding to a metal ion.

Sequence Features

Domain/signature hits from InterPro and related databases.

14 records
Show feature table
Start End DB Term Name
26 31 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
35 116 ProSiteProfiles PS51007 Cytochrome c family profile.
35 116 InterPro IPR009056 Cytochrome c-like domain
41 109 Pfam PF13442 Cytochrome C oxidase, cbb3-type, subunit III
41 109 InterPro IPR009056 Cytochrome c-like domain
14 25 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
32 119 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 31 Phobius SIGNAL_PEPTIDE Signal peptide region
1 13 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 31 SignalP_EUK SignalP-noTM SignalP-noTM
29 111 Gene3D G3DSA:1.10.760.10 -
29 111 InterPro IPR036909 Cytochrome c-like domain superfamily
14 110 SUPERFAMILY SSF46626 Cytochrome c
14 110 InterPro IPR036909 Cytochrome c-like domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 6TP9
X-ray 2.19 Å A,B,C,D,E,F,G,H,I,J,K
73.9% 32-119
PDBe RCSB PDBj File
Viewing
AlphaFold PA0517
AlphaFold — — full sequence — Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.674

Pockets (P2RANK)

Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).

P2RANK Sticks Spheres Surfaces Score Probability Labels Zoom Positions
1 5.59 0.268