Protein profile

PA0557

hypothetical protein

Genome: NC_002516.2

Gene: PA0557 Structure source: AlphaFold UniProt Q9I5X9

Export view

Amino acids 218

Annotations 0

Features 6

PDB binders 0

Druggability 0.72

Overview

Basic information about this protein and its source genome.

Accession: PA0557
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0557
Status: annotated
Amino acids: 218
Structure source: AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.72

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MRDLLGGRESPRYSTAVFPRIPDERFKALRGVARSHWSGASWTSRGRGYCRSEGPPDDQGKSIPAHAGVPRHNQESAMSSEVSAIRQLIEDWRAAVRASDVPRIVSYYAEDIVAFDAILQLQFKGRDAYQKHWQACTEMCKGPMTFDIAELQIHADPQVAFAHYLCHCGGTGPDGQPHSSWMRVSAGYRKHGDGWKVIHEHFSAPFDMDGKALFDLQP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

6 records

Show feature table

Start	End	DB	Term	Name
85	206	Pfam	PF13474	SnoaL-like domain
85	206	InterPro	IPR037401	SnoaL-like domain
76	205	SUPERFAMILY	SSF54427	NTF2-like
76	205	InterPro	IPR032710	NTF2-like domain superfamily
78	218	Gene3D	G3DSA:3.10.450.50	-
1	218	PANTHER	PTHR35174	BLL7171 PROTEIN-RELATED

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0557	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.72