Protein profile

PA0581

glycerol-3-phosphate acyltransferase PlsY

Genome: NC_002516.2

Gene: plsY PA0581 Structure source: AlphaFold UniProt Q9I5V6
Amino acids 189
Annotations 4
Features 26
PDB binders 8
Druggability 0.688

Overview

Basic information about this protein and its source genome.

Accession
PA0581
Gene
plsY PA0581
Status
annotated
Amino acids
189
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.688
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MVWLLAILAYLLGSLSFAVLLSRWFGTQDPRASGSGNPGATNMLRVAGKKLAILTLLGDVGKGLLPVLVARWLGLGVMEEAWVGIAAVIGHLYPLYFNFRGGKGVATAAGMLLGLYPPAVLLAAAAWLLTFKLSRTSSLASLVATPLTLPLLAWQQPGALLPMTVLTGLIVWRHRANLRDLFAGRERHF

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 3 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

3
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0043772 Catalysis of the reaction: acyl phosphate + sn-glycerol 3-phosphate = 1-acyl-sn-glycerol 3-phosphate + orthophosphate.
  • GO:0008654 The chemical reactions and pathways resulting in the formation of a phospholipid, a lipid containing phosphoric acid as a mono- or diester.

Sequence Features

Domain/signature hits from InterPro and related databases.

26 records
Show feature table
Start End DB Term Name
83 102 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
7 182 SMART SM01207 G3P_acyltransf_2
7 182 InterPro IPR003811 Glycerol-3-phosphate acyltransferase, PlsY
3 187 NCBIfam TIGR00023 glycerol-3-phosphate 1-O-acyltransferase PlsY
3 187 InterPro IPR003811 Glycerol-3-phosphate acyltransferase, PlsY
151 172 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
51 73 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
132 150 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
109 131 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
81 99 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
111 131 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
100 110 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
2 13 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
173 189 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
1 1 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 18 Phobius SIGNAL_PEPTIDE Signal peptide region
14 18 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
4 189 Hamap MF_01043 Glycerol-3-phosphate acyltransferase [plsY].
4 189 InterPro IPR003811 Glycerol-3-phosphate acyltransferase, PlsY
151 173 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
19 80 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
4 26 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
2 188 PANTHER PTHR30309 INNER MEMBRANE PROTEIN YGIH
2 188 InterPro IPR003811 Glycerol-3-phosphate acyltransferase, PlsY
8 181 Pfam PF02660 Glycerol-3-phosphate acyltransferase
8 181 InterPro IPR003811 Glycerol-3-phosphate acyltransferase, PlsY

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0581
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.688
3 0.472

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
78M O66905 314.5 Da LogP 3.75 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCC/C=C\CCCCCC(=O)OC[C@H](CO)O
79M O66905 328.5 Da LogP 4.14 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCCC/C=C\CCCCCC(=O)OC[C@@H](CO)O
87O O66905 336.4 Da LogP 5.10 TPSA 83.8 1 viol. ✓ Clean CCCCCCCCCCCCCCCC(=O)OP(=O)(O)O
FME O66905 177.2 Da LogP -0.06 TPSA 66.4 ✓ Ro5 ✓ Clean CSCC[C@@H](C(=O)O)NC=O
G3P O66905 172.1 Da LogP -1.55 TPSA 107.2 ✓ Ro5 ✓ Clean C([C@H](COP(=O)(O)O)O)O
NKO O66905 410.5 Da LogP 4.48 TPSA 113.3 ✓ Ro5 ✓ Clean CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(=O)(O)O)O
OLC O66905 356.5 Da LogP 4.92 TPSA 66.8 ✓ Ro5 ✓ Clean CCCCCCCC\C=C/CCCCCCCC(=O)OC[C@@H](CO)O
SEY O66905 123.0 Da LogP -1.84 TPSA 52.0 ✓ Ro5 ✓ Clean C(=[Se])(N)N

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.