Protein profile

PA0610

transcriptional regulator PrtN

Genome: NC_002516.2

Gene: prtN PA0610 Structure source: AlphaFold UniProt Q06552

Export view

Amino acids 104

Annotations 4

Features 2

PDB binders 0

Druggability 0.732

Overview

Basic information about this protein and its source genome.

Accession: PA0610
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: prtN PA0610
Status: annotated
Amino acids: 104
Structure source: AlphaFold

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0030152 The chemical reactions and pathways resulting in the formation of a bacteriocin, any of a heterogeneous group of polypeptide antibiotics that are secreted by certain bacterial strains and are able to kill cells of other susceptible (frequently related) strains after adsorption at specific receptors on the cell surface. They include the colicins, and their mechanisms of action vary. GO:1900378 Any process that activates or increases the frequency, rate or extent of secondary metabolite biosynthetic process. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.732

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MQPSIAPSTPIPRQETVELVYRIFGDVLVPLEQVRERWFRNLNKENFSKALACGRIALPVTTLDDSHKAMQFVALDHLAAYVDQRANQAGSARRAQPGADSIAS

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
GO:0030152 The chemical reactions and pathways resulting in the formation of a bacteriocin, any of a heterogeneous group of polypeptide antibiotics that are secreted by certain bacterial strains and are able to kill cells of other susceptible (frequently related) strains after adsorption at specific receptors on the cell surface. They include the colicins, and their mechanisms of action vary.
GO:1900378 Any process that activates or increases the frequency, rate or extent of secondary metabolite biosynthetic process.
GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

2 records

Show feature table

Start	End	DB	Term	Name
16	89	Pfam	PF11112	Pyocin activator protein PrtN
16	89	InterPro	IPR020518	Transcription regulator PrtN

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0610	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
3				0.732
2				0.309