Protein profile

PA0638

bacteriophage protein

Genome: NC_002516.2

Gene: PA0638 Structure source: AlphaFold UniProt Q9I5S8
Export view
Amino acids 231
Annotations 4
Features 4
PDB binders 0
Druggability 0.758

Overview

Basic information about this protein and its source genome.

Accession
PA0638
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA0638
Status
annotated
Amino acids
231
Structure source
AlphaFold
GO
GO:0030430 The cytoplasm of a host cell. GO:0051536 Binding to an iron-sulfur cluster, a combination of iron and sulfur atoms. GO:0046718 The process by which a symbiont breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the symbiont or its genome is released into the host cell. GO:0098015 Part of the virion that may be used to recognize, attach and inject the viral genome and accessory proteins into the host cell.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.758
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MTITADDQTLEPGALVRLFDLDCTGFGGEMLRFHGHLQQGPIHWQGNAYQAWPLEARGFEQRGDGRASSPTLSVGNIDGSISALCLFFDGLVGARLIVRETYAHYLDAANFAEGNPQADPSQERLNIWFLEQKTAENSVQVTWELSAPPDFQGQQIPARQITSLCHWCITNEYRGQDCNYTGTAMFDADGNPVDDPALDRCGGRVSDCKLRFGADNPLSHGGFAGAGLVRM

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0030430 The cytoplasm of a host cell.
  • GO:0051536 Binding to an iron-sulfur cluster, a combination of iron and sulfur atoms.
  • GO:0046718 The process by which a symbiont breaches the plasma membrane or cell envelope and enters the host cell. The process ends when the symbiont or its genome is released into the host cell.
  • GO:0098015 Part of the virion that may be used to recognize, attach and inject the viral genome and accessory proteins into the host cell.

Sequence Features

Domain/signature hits from InterPro and related databases.

4 records
Show feature table
Start End DB Term Name
7 226 NCBIfam TIGR01600 phage minor tail protein L
7 226 InterPro IPR006487 Bacteriophage lambda, Tail tip protein L
24 228 Pfam PF05100 Phage minor tail protein L
24 228 InterPro IPR006487 Bacteriophage lambda, Tail tip protein L

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0638
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.758