Protein profile

PA0650

anthranilate phosphoribosyltransferase

Genome: NC_002516.2

Gene: trpD PA0650 Structure source: AlphaFold UniProt P20574
Amino acids 349
Annotations 6
Features 20
PDB binders 17
Druggability 0.69

Overview

Basic information about this protein and its source genome.

Accession
PA0650
Gene
trpD PA0650
Status
annotated
Amino acids
349
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.69
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MDIKGALNRIVNQLDLTTEEMQAVMRQIMTGQCTDAQIGAFLMGMRMKSETIDEIVGAVAVMRELADGVQLPTLKHVVDVVGTGGDGANIFNVSSAASFVVAAAGGKVAKHGNRAVSGKSGSADLLEAAGIYLELTSEQVARCIDTVGVGFMFAQVHHKAMKYAAGPRRELGLRTLFNMLGPLTNPAGVRHQVVGVFTQELCKPLAEVLKRLGSEHVLVVHSRDGLDEFSLAAATHIAELKDGEVREYEVRPEDFGIKSQTLMGLEVDSPQASLELIRDALGRRKTEAGQKAAELIVMNAGPALYAADLATSLHEGIQLAHDALHTGLAREKMDELVAFTAVYREENAQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

5
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0004048 Catalysis of the reaction: N-(5-phospho-beta-D-ribosyl)anthranilate + diphosphate = 5-phospho-alpha-D-ribose 1-diphosphate + anthranilate.
  • GO:0000287 Binding to a magnesium (Mg) ion.
  • GO:0000162 The chemical reactions and pathways resulting in the formation of L-tryptophan, the chiral amino acid 2-amino-3-(1H-indol-3-yl)propanoic acid; L-tryptophan is synthesized from chorismate via anthranilate.
  • GO:0016757 Catalysis of the transfer of a glycosyl group from one compound (donor) to another (acceptor).

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
75 340 SUPERFAMILY SSF52418 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain
75 340 InterPro IPR035902 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain superfamily
7 338 NCBIfam TIGR01245 anthranilate phosphoribosyltransferase
7 338 InterPro IPR005940 Anthranilate phosphoribosyl transferase
73 342 FunFam G3DSA:3.40.1030.10:FF:000002 Anthranilate phosphoribosyltransferase
73 347 Gene3D G3DSA:3.40.1030.10 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain
73 347 InterPro IPR035902 Nucleoside phosphorylase/phosphoribosyltransferase catalytic domain superfamily
1 67 SUPERFAMILY SSF47648 Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain
1 67 InterPro IPR036320 Glycosyl transferase family 3, N-terminal domain superfamily
75 329 Pfam PF00591 Glycosyl transferase family, a/b domain
75 329 InterPro IPR000312 Glycosyl transferase, family 3
5 339 Hamap MF_00211 Anthranilate phosphoribosyltransferase [trpD].
5 339 InterPro IPR005940 Anthranilate phosphoribosyl transferase
6 65 Pfam PF02885 Glycosyl transferase family, helical bundle domain
6 65 InterPro IPR017459 Glycosyl transferase family 3, N-terminal domain
7 27 Coils Coil Coil
2 341 PANTHER PTHR43285 ANTHRANILATE PHOSPHORIBOSYLTRANSFERASE
2 341 InterPro IPR005940 Anthranilate phosphoribosyl transferase
1 70 FunFam G3DSA:1.20.970.10:FF:000006 Anthranilate phosphoribosyltransferase
1 70 Gene3D G3DSA:1.20.970.10 Transferase, Pyrimidine Nucleoside Phosphorylase; Chain C

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0650
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.566

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

67 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
17C P9WFX5 257.2 Da LogP 2.83 TPSA 86.6 ✓ Ro5 ✓ Clean c1ccc(c(c1)C(=O)O)Nc2ccccc2C(=O)O
4M0 P9WFX5 151.2 Da LogP 1.28 TPSA 63.3 ✓ Ro5 ✓ Clean Cc1ccc(c(c1)N)C(=O)O
59L A5U4M0 316.3 Da LogP 3.04 TPSA 129.8 ✓ Ro5 ✓ Clean Cc1cccc(c1Nc2cc(ccc2C(=O)O)[N+](=O)[O-])C(=O)O
61L A5U4M0 287.4 Da LogP 4.47 TPSA 49.3 ✓ Ro5 ✓ Clean Cc1ccc(c(c1)Nc2c(cccc2SC)C)C(=O)O
62L A5U4M0 319.4 Da LogP 3.15 TPSA 83.5 ✓ Ro5 ✓ Clean Cc1ccc(c(c1)Nc2c(cccc2S(=O)(=O)C)C)C(=O)O
644 P9WFX5 392.4 Da LogP 4.27 TPSA 136.0 ✓ Ro5 ✓ Clean c1ccc(c(c1)C(=O)O)Nc2cccc(c2C(=O)O)Nc3ccccc3C(=…
7P1 A5U4M0 395.3 Da LogP 2.77 TPSA 153.4 ✓ Ro5 Alert c1ccc(c(c1)C(=O)O)Nc2ccc(cc2C(=O)O)OCCCP(=O)(O)O
7P2 A5U4M0 409.3 Da LogP 3.16 TPSA 153.4 ✓ Ro5 Alert c1ccc(c(c1)C(=O)O)Nc2ccc(cc2C(=O)O)OCCCCP(=O)(O…
7P3 P9WFX5 423.4 Da LogP 3.55 TPSA 153.4 ✓ Ro5 Alert c1ccc(c(c1)C(=O)O)Nc2ccc(cc2C(=O)O)OCCCCCP(=O)(…
BE2 P9WFX5 137.1 Da LogP 0.97 TPSA 63.3 ✓ Ro5 ✓ Clean c1ccc(c(c1)C(=O)O)N
BEN P9WFX5 120.2 Da LogP 0.97 TPSA 49.9 ✓ Ro5 ✓ Clean [H]/N=C(\c1ccccc1)/N
CXS Q8PD71 221.3 Da LogP 1.19 TPSA 66.4 ✓ Ro5 ✓ Clean C1CCC(CC1)NCCCS(=O)(=O)O
FA0 P9WFX5 155.1 Da LogP 1.11 TPSA 63.3 ✓ Ro5 ✓ Clean c1cc(c(cc1F)N)C(=O)O
MLT P9WFX5 134.1 Da LogP -1.09 TPSA 94.8 ✓ Ro5 ✓ Clean C([C@H](C(=O)O)O)C(=O)O
POP P9WFX5 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
PRP A5U4M0 390.1 Da LogP -2.23 TPSA 229.7 1 viol. ✓ Clean C([C@@H]1[C@H]([C@H]([C@H](O1)O[P@@](=O)(O)OP(=…
TA7 A5U4M0 246.2 Da LogP 2.40 TPSA 43.4 ✓ Ro5 ✓ Clean COc1ccc(cc1)C(=O)CC(=O)C(F)(F)F

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.