Overview
Basic information about this protein and its source genome.
- Accession
- PA0659
- Gene
- PA0659
- Status
- annotated
- Amino acids
- 358
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MTDQRFKIVFSGELMPDASLETVKDNLARLFKSEPGKIDALFGGRPVVLKRELPEAEAERYLTALRQAGANAYKEVDLAASLSLVETPDHNPQVAEETPAQDLPPMTCPKCGHEQPSGAECSACGVIIEKYLARQAQLGENAAPAATAAAGASPYTPPSAQVGDTLPEFGELNVFTTNGRIGRLRYLGWSMAMTLCFLVIMGLGFLLGETVGVAVTALASIAFIVIAVMIGVQRLHDLGWSGWLWLLNFVPFVGSVFGILMLVLPGSTGANRYGPPPPANSTGVKVLASLIILLPIVGIIAAIALPSYQGYLERANYDGGASAPADPYTTDEQAAAAAAEADEAATAAAEAMEDDDQQ
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
- GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 306 | 358 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 244 | 266 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 30 | 358 | PANTHER | PTHR34980 | INNER MEMBRANE PROTEIN-RELATED-RELATED |
| 30 | 358 | InterPro | IPR008523 | Protein of unknown function DUF805 |
| 287 | 358 | Gene3D | G3DSA:3.30.700.10 | Glycoprotein, Type 4 Pilin |
| 175 | 277 | Pfam | PF05656 | Protein of unknown function (DUF805) |
| 175 | 277 | InterPro | IPR008523 | Protein of unknown function DUF805 |
| 213 | 232 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 208 | 212 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 284 | 305 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 244 | 264 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 186 | 208 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 213 | 232 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 233 | 243 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
| 286 | 308 | TMHMM | TMhelix | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 265 | 283 | Phobius | NON_CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region. |
| 290 | 323 | SUPERFAMILY | SSF54523 | Pili subunits |
| 290 | 323 | InterPro | IPR045584 | Pilin-like |
| 186 | 207 | Phobius | TRANSMEMBRANE | Region of a membrane-bound protein predicted to be embedded in the membrane. |
| 1 | 185 | Phobius | CYTOPLASMIC_DOMAIN | Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm. |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0659
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.769 | ||||||
| 5 | 0.622 | ||||||
| 3 | 0.513 |