Protein profile

PA0659

hypothetical protein

Genome: NC_002516.2

Gene: PA0659 Structure source: AlphaFold UniProt Q9I5R2
Export view
Amino acids 358
Annotations 2
Features 20
PDB binders 0
Druggability 0.769

Overview

Basic information about this protein and its source genome.

Accession
PA0659
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA0659
Status
annotated
Amino acids
358
Structure source
AlphaFold
GO
GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.769
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MTDQRFKIVFSGELMPDASLETVKDNLARLFKSEPGKIDALFGGRPVVLKRELPEAEAERYLTALRQAGANAYKEVDLAASLSLVETPDHNPQVAEETPAQDLPPMTCPKCGHEQPSGAECSACGVIIEKYLARQAQLGENAAPAATAAAGASPYTPPSAQVGDTLPEFGELNVFTTNGRIGRLRYLGWSMAMTLCFLVIMGLGFLLGETVGVAVTALASIAFIVIAVMIGVQRLHDLGWSGWLWLLNFVPFVGSVFGILMLVLPGSTGANRYGPPPPANSTGVKVLASLIILLPIVGIIAAIALPSYQGYLERANYDGGASAPADPYTTDEQAAAAAAEADEAATAAAEAMEDDDQQ

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

20 records
Show feature table
Start End DB Term Name
306 358 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
244 266 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
30 358 PANTHER PTHR34980 INNER MEMBRANE PROTEIN-RELATED-RELATED
30 358 InterPro IPR008523 Protein of unknown function DUF805
287 358 Gene3D G3DSA:3.30.700.10 Glycoprotein, Type 4 Pilin
175 277 Pfam PF05656 Protein of unknown function (DUF805)
175 277 InterPro IPR008523 Protein of unknown function DUF805
213 232 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
208 212 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
284 305 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
244 264 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
186 208 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
213 232 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
233 243 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
286 308 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
265 283 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
290 323 SUPERFAMILY SSF54523 Pili subunits
290 323 InterPro IPR045584 Pilin-like
186 207 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
1 185 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0659
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.769
5 0.622
3 0.513