Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA0680
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0680
Status: annotated
Amino acids: 124
Structure source: AlphaFold

GO

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0015627 A large protein complex, containing 12-15 subunits, that spans the cell envelope of Gram-negative bacteria and mediates the movement of proteins into the extracellular environment. The complex includes a component in the cytoplasm, an inner membrane subcomplex that reaches into the periplasmic compartment and a secretion pore in the outer membrane. Proteins using the Type II pathway are transported across the cytoplasmic membrane by the Sec or Tat complex. GO:0015628 The process in which proteins are secreted across the outer membrane of Gram-negative bacteria by the type II secretion system. Proteins using this pathway are first translocated across the cytoplasmic membrane via the Sec or Tat pathways.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.687

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSTRLSSRGFTLIEVLVALAIVAIALAAAIRAVGLMTDGNGLLRDKSLALLAAESRLAELRLGVGAAPGNSDFECSQGRLRLYCEQRVEATDDPALLWVEIRVRTQREQAVPLARLNTLLSRSR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0015627 A large protein complex, containing 12-15 subunits, that spans the cell envelope of Gram-negative bacteria and mediates the movement of proteins into the extracellular environment. The complex includes a component in the cytoplasm, an inner membrane subcomplex that reaches into the periplasmic compartment and a secretion pore in the outer membrane. Proteins using the Type II pathway are transported across the cytoplasmic membrane by the Sec or Tat complex.
GO:0015628 The process in which proteins are secreted across the outer membrane of Gram-negative bacteria by the type II secretion system. Proteins using this pathway are first translocated across the cytoplasmic membrane via the Sec or Tat pathways.

Sequence Features

Domain/signature hits from InterPro and related databases.

19 records

Show feature table

Start	End	DB	Term	Name
12	34	Phobius	TRANSMEMBRANE	Region of a membrane-bound protein predicted to be embedded in the membrane.
1	120	PANTHER	PTHR38779	TYPE II SECRETION SYSTEM PROTEIN I-RELATED
1	120	InterPro	IPR010052	Type II secretion system protein GspI
38	120	Gene3D	G3DSA:3.30.1300.30	-
9	107	NCBIfam	TIGR01707	type II secretion system minor pseudopilin GspI
9	107	InterPro	IPR010052	Type II secretion system protein GspI
8	28	ProSitePatterns	PS00409	Prokaryotic N-terminal methylation site.
8	28	InterPro	IPR012902	Prokaryotic N-terminal methylation site
12	34	TMHMM	TMhelix	Region of a membrane-bound protein predicted to be embedded in the membrane.
43	120	Pfam	PF02501	Type II secretion system (T2SS), protein I
43	120	InterPro	IPR003413	Type II secretion system protein GspI, C-terminal
8	30	NCBIfam	TIGR02532	prepilin-type N-terminal cleavage/methylation domain
8	30	InterPro	IPR012902	Prokaryotic N-terminal methylation site
1	11	Phobius	NON_CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
6	29	Pfam	PF07963	Prokaryotic N-terminal methylation motif
6	29	InterPro	IPR012902	Prokaryotic N-terminal methylation site
35	124	Phobius	CYTOPLASMIC_DOMAIN	Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
41	120	SUPERFAMILY	SSF54523	Pili subunits
41	120	InterPro	IPR045584	Pilin-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0680	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.687

PA0680