Protein profile

PA0723

phage coat protein B

Genome: NC_002516.2

Gene: PA4673.7 coaB PA0723 Structure source: AlphaFold UniProt Q9I5K5
Amino acids 82
Annotations 0
Features 15
PDB binders 0
Druggability 0.738

Overview

Basic information about this protein and its source genome.

Accession
PA0723
Gene
PA4673.7 coaB PA0723
Status
annotated
Amino acids
82
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
CytoplasmicMembrane

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.738
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKAMKQRIAKFSPVASFRNLCIAGSVTAATSLPAFAGVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

15 records
Show feature table
Start End DB Term Name
37 59 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
80 82 Phobius CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the cytoplasm.
20 32 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.
1 36 Phobius SIGNAL_PEPTIDE Signal peptide region
1 28 SignalP_GRAM_POSITIVE SignalP-TM SignalP-TM
26 78 Pfam PF05356 Inovirus Coat protein B
26 78 InterPro IPR008020 Capsid protein G8P
57 79 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 36 SignalP_GRAM_NEGATIVE SignalP-TM SignalP-TM
37 82 SUPERFAMILY SSF57987 Inovirus (filamentous phage) major coat protein
60 79 Phobius TRANSMEMBRANE Region of a membrane-bound protein predicted to be embedded in the membrane.
20 42 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
1 19 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
33 36 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
37 82 Gene3D G3DSA:1.20.5.230 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0723
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.738