Protein profile

PA0759

hypothetical protein

Genome: NC_002516.2

Gene: PA0759 Structure source: AlphaFold UniProt Q9I5H0

Export view

Amino acids 314

Annotations 1

Features 10

PDB binders 0

Druggability 0.727

Overview

Basic information about this protein and its source genome.

Accession: PA0759
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0759
Status: annotated
Amino acids: 314
Structure source: AlphaFold

GO:0016226 The incorporation of iron and exogenous sulfur into a metallo-sulfur cluster.

Target profile

Computed evidence for target prioritization.

Human off-target: hit
Human identity (%): 33.645
Human E-value: 3.38e-07
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.727

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MADPAFHTPLVHEGILAVRGPDAAKFLQGQLTCNLAYLNDETSSLGGRCNIKGRLLSSFRILPEGDGLLLAMAGELLEAQLADLKKYAVFSKASLADESAAWLRIGLRDASEALRALGIDTPAESGRIARHGDLLAVALGDGRVELWVPAQRAEAVLATLREHSREAPLDDWLLGQVRAGIGQVFGATRELFIPQMINLQAVGGVSFKKGCYTGQEIVARMQYLGRLKRRLYRLALDADEVPAPGTGLFSPVHSTSVGEVVLAARTPENSVELLAVLQDDAVADGRISLGSAEGAPLVLLNLPYTLDSDREIQR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0016226 The incorporation of iron and exogenous sulfur into a metallo-sulfur cluster.

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records

Show feature table

Start	End	DB	Term	Name
4	225	SUPERFAMILY	SSF103025	Folate-binding domain
7	281	PANTHER	PTHR22602	UNCHARACTERIZED
7	281	InterPro	IPR045179	YgfZ/GcvT
180	295	Gene3D	G3DSA:2.40.30.160	-
228	307	SUPERFAMILY	SSF101790	Aminomethyltransferase beta-barrel domain
228	307	InterPro	IPR029043	Glycine cleavage T-protein/YgfZ, C-terminal
12	174	Gene3D	G3DSA:3.30.70.1630	-
13	100	Gene3D	G3DSA:3.30.70.1400	-
171	235	NCBIfam	TIGR03317	folate-binding protein YgfZ
171	235	InterPro	IPR017703	YgfZ/GcvT conserved site

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0759	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
6				0.727
1				0.709