Overview
Basic information about this protein and its source genome.
- Accession
- PA0791
- Gene
- PA0791
- Status
- annotated
- Amino acids
- 262
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- CytoplasmicMembrane
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MRNASIEQYDATPRAVVAMGTDYPDGYLLPRHRHRRAQLLYGASGVMQVRTGDAGWVVPPQRAVWIPPGVEHEVRMLGVSTRSLYIEPGSAMAMPAHCQVLAVSPLLRQLLLAAVDMPLEYDTEGRDGALATLLLHELAAAETLPLHVPLPPEPRWLALCEAFLVEPDIRASAERWAGLLHTSLRSFNRTFRRYTGLSFGAWKQRACVVQALARLAGGETVTAIALDCGYQSPAAFSTMFRRVLGQPPSAFQAGALRSPGGP
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
5- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
- GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
- GO:0043565 Binding to DNA of a specific nucleotide composition, e.g. GC-rich DNA binding, or with a specific sequence motif or type of DNA e.g. promotor binding or rDNA binding.
- GO:0009893 Any process that activates or increases the frequency, rate or extent of the chemical reactions and pathways within a cell or an organism.
- GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 158 | 255 | Gene3D | G3DSA:1.10.10.60 | - |
| 205 | 248 | ProSitePatterns | PS00041 | Bacterial regulatory proteins, araC family signature. |
| 205 | 248 | InterPro | IPR018062 | HTH domain AraC-type, conserved site |
| 176 | 252 | Pfam | PF12833 | Helix-turn-helix domain |
| 176 | 252 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 11 | 92 | Gene3D | G3DSA:2.60.120.10 | Jelly Rolls |
| 11 | 92 | InterPro | IPR014710 | RmlC-like jelly roll fold |
| 16 | 109 | CDD | cd06124 | cupin_NimR-like_N |
| 151 | 255 | FunFam | G3DSA:1.10.10.60:FF:000132 | AraC family transcriptional regulator |
| 10 | 179 | SUPERFAMILY | SSF51182 | RmlC-like cupins |
| 10 | 179 | InterPro | IPR011051 | RmlC-like cupin domain superfamily |
| 3 | 255 | PANTHER | PTHR11019 | HTH-TYPE TRANSCRIPTIONAL REGULATOR NIMR |
| 170 | 252 | SMART | SM00342 | aracneu4 |
| 170 | 252 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 211 | 254 | SUPERFAMILY | SSF46689 | Homeodomain-like |
| 211 | 254 | InterPro | IPR009057 | Homeobox-like domain superfamily |
| 221 | 236 | PRINTS | PR00032 | AraC bacterial regulatory protein HTH signature |
| 221 | 236 | InterPro | IPR020449 | Transcription regulator HTH, AraC- type |
| 236 | 252 | PRINTS | PR00032 | AraC bacterial regulatory protein HTH signature |
| 236 | 252 | InterPro | IPR020449 | Transcription regulator HTH, AraC- type |
| 154 | 254 | ProSiteProfiles | PS01124 | Bacterial regulatory proteins, araC family DNA-binding domain profile. |
| 154 | 254 | InterPro | IPR018060 | DNA binding HTH domain, AraC-type |
| 25 | 118 | Pfam | PF02311 | AraC-like ligand binding domain |
| 25 | 118 | InterPro | IPR003313 | AraC-type arabinose-binding/dimerisation domain |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0791
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.641 | ||||||
| 1 | 0.517 |