Protein profile

PA0843

phospholipase C accessory protein PlcR

Genome: NC_002516.2

Gene: plcR Structure source: AlphaFold
Amino acids 207
Annotations 2
Features 11
PDB binders 0
Druggability 0.667

Overview

Basic information about this protein and its source genome.

Accession
PA0843
Gene
plcR
Status
annotated
Amino acids
207
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Extracellular

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.667
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MRPTLTWTLLALLLCGTAIGAVLLFYPSEPAPVAPFASPPQATPAAKPSIPSRAPEMNTATAPDNLEQQLGEFGRNAGQMSEIERKQAAEGLIEQLKREVAVGADPRQTFEEIQRLTPYVEADARRREALDFEIWMALKDNASVQQQAPTPGEEEQLREYAQESDKVIAEVLASVDDEEQRHAAIDERLKALRKQIFGEENPRLLQR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).

Sequence Features

Domain/signature hits from InterPro and related databases.

11 records
Show feature table
Start End DB Term Name
1 20 SignalP_EUK SignalP-TM SignalP-TM
175 195 Coils Coil Coil
37 64 MobiDBLite mobidb-lite consensus disorder prediction
5 27 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.
16 20 Phobius SIGNAL_PEPTIDE_C_REGION C-terminal region of a signal peptide.
66 205 NCBIfam TIGR03398 phospholipase C accessory protein PlcR
66 205 InterPro IPR017769 Phospholipase C accessory protein PlcR
21 207 Phobius NON_CYTOPLASMIC_DOMAIN Region of a membrane-bound protein predicted to be outside the membrane, in the extracellular region.
1 3 Phobius SIGNAL_PEPTIDE_N_REGION N-terminal region of a signal peptide.
1 20 Phobius SIGNAL_PEPTIDE Signal peptide region
4 15 Phobius SIGNAL_PEPTIDE_H_REGION Hydrophobic region of a signal peptide.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0843
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.667
1 0.258