Protein profile

PA0853

oxidoreductase

Genome: NC_002516.2

Gene: PA0853 Structure source: AlphaFold UniProt Q9I588
Amino acids 207
Annotations 2
Features 7
PDB binders 60
Druggability 0.736

Overview

Basic information about this protein and its source genome.

Accession
PA0853
Gene
PA0853
Status
annotated
Amino acids
207
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
39.683
Human E-value
1.4e-09
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.736
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MVETAKTGATPLEGDGKRILLIVGSPKRKSFCHLLAECYAQGARSKDHVVRELKLGELAFDPILHEGYEQSQVLEPDLLEAQRQIHWAEHLVFVYPVWWGGLPALLQGFFDRVLQPGFAFRYRGTQDKDWEQLLGGRSADLLVCHDQPLSRLRFLKGPPAHRQMVRSVLGACGIATRRLEEFAPMRSSSEEQRQGWLRRAEQLGSQV

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

2
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0003955 Catalysis of the reaction: NAD(P)H + H+ + a quinone = NAD(P)+ + a quinol.

Sequence Features

Domain/signature hits from InterPro and related databases.

7 records
Show feature table
Start End DB Term Name
17 202 InterPro IPR003680 Flavodoxin-like fold
17 203 PANTHER PTHR10204 NAD P H OXIDOREDUCTASE-RELATED
17 202 Pfam PF02525 Flavodoxin-like fold
16 207 Gene3D G3DSA:3.40.50.360 -
16 207 InterPro IPR029039 Flavoprotein-like superfamily
17 207 SUPERFAMILY SSF52218 Flavoproteins
17 207 InterPro IPR029039 Flavoprotein-like superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0853
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.736
2 0.543

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

210 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
0TX P16083 319.9 Da LogP 4.81 TPSA 28.2 ✓ Ro5 ✓ Clean CCN(CC)CCC[C@H](C)Nc1ccnc2c1ccc(c2)Cl
1PQ P16083 259.4 Da LogP 2.78 TPSA 60.2 ✓ Ro5 ✓ Clean C[C@@H](CCCN)Nc1cc(cc2c1nccc2)OC
340 P15559 311.3 Da LogP 2.82 TPSA 57.5 ✓ Ro5 Alert Cc1c(c2c(n1C)C(=O)C=C(C2=O)OC)COc3ccccc3
372 P16083 243.3 Da LogP 1.62 TPSA 73.2 ✓ Ro5 ✓ Clean CC(=O)Nc1ccc2c(c1)C(C(=O)N2C)CC#N
3ZU P16083 268.3 Da LogP 2.10 TPSA 78.4 ✓ Ro5 ✓ Clean COc1ccc2c(c1)C(=O)C(=[N+]2[O-])c3ccc(cc3)N
3ZV P16083 267.3 Da LogP 3.02 TPSA 47.9 ✓ Ro5 ✓ Clean COc1ccc(cc1)C2=Nc3ccc(cc3C2=O)OC
465 P16083 303.7 Da LogP 1.49 TPSA 114.7 ✓ Ro5 ✓ Clean CN1c2c3c(cc(nc3c(c(c2N)Cl)N=C)C(=O)N)C1=O
4X4 P16083 374.4 Da LogP 3.54 TPSA 84.6 ✓ Ro5 ✓ Clean COc1ccc2c([nH]1)c(c3n2cc4c3nccc4)CCNC(=O)c5ccco5
52X P16083 401.2 Da LogP 2.63 TPSA 83.2 ✓ Ro5 ✓ Clean CC(=O)NCCc1c2cc(ccc2[nH]c1I)NC(=O)OC
695 P16083 306.4 Da LogP 1.43 TPSA 75.3 ✓ Ro5 ✓ Clean CC(=O)NCCc1cccc2c1cc(cc2)S(=O)(=O)NC
6A1 P16083 357.4 Da LogP 2.24 TPSA 79.0 ✓ Ro5 ✓ Clean C[N+](C)(CCNC1CCc2c3c1c(c4cc(ccc4n3cn2)OC)O)O
6T0 P16083 240.3 Da LogP 2.82 TPSA 56.7 ✓ Ro5 ✓ Clean CC(C)Cn1cnc2c1c3ccccc3nc2N
6T2 P16083 443.6 Da LogP 3.92 TPSA 78.4 ✓ Ro5 ✓ Clean CC1(COC1)COc2ccc3c(c2)ncn3c4ccc5cccc(c5n4)N6CCC…
79X P16083 295.3 Da LogP 3.03 TPSA 60.7 ✓ Ro5 ✓ Clean COc1cc-2c(cc1OC)C(=O)n3c2cc4c3ccc(c4)O
936 P15559 356.3 Da LogP 2.73 TPSA 100.7 ✓ Ro5 Alert Cc1c(c2c(n1C)C(=O)C=C(C2=O)OC)COc3ccc(cc3)[N+](…
A2Z P16083 217.2 Da LogP 1.58 TPSA 40.5 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1ccc3c2OCO3)C
A7B P16083 189.2 Da LogP 1.85 TPSA 42.1 ✓ Ro5 ✓ Clean CC1=CC(=O)Nc2c1cccc2OC
AA P16083 195.2 Da LogP 2.39 TPSA 40.2 ✓ Ro5 Alert c1ccc2c(c1)c(c3ccccc3[nH+]2)N
AD1 P16083 179.2 Da LogP -0.75 TPSA 57.6 ✓ Ro5 Alert CN1C[C@H](C2=CC(=O)C(=O)C=C21)O
AO P16083 266.4 Da LogP 2.94 TPSA 20.6 ✓ Ro5 ✓ Clean CN(C)c1ccc2cc3ccc(cc3[nH+]c2c1)N(C)C
ARH P15559 322.4 Da LogP 2.15 TPSA 62.3 ✓ Ro5 Alert C[C@@H]1C[N@@]1C2=CC(=O)c3c(c(c(n3C)c4ccccc4)CO…
BTB P15559 209.2 Da LogP -3.01 TPSA 104.4 ✓ Ro5 ✓ Clean C(CO)N(CCO)C(CO)(CO)CO
C09 P16083 242.3 Da LogP 2.23 TPSA 76.8 ✓ Ro5 ✓ Clean CCOCc1[nH]c2c3ccccc3nc(c2n1)N
CB1 P16083 252.2 Da LogP 0.42 TPSA 132.4 ✓ Ro5 ✓ Clean c1c(c(cc(c1N2CC2)[N+](=O)[O-])[N+](=O)[O-])C(=O…
CBD P05982 774.2 Da LogP 3.85 TPSA 298.0 3 viol. Alert c1ccc2c(c1)C(=O)c3c(cc(c(c3C2=O)N)S(=O)(=O)O)Nc…
CC2 P15559 330.4 Da LogP 4.86 TPSA 50.4 ✓ Ro5 ✓ Clean Cc1cc2c(cc1C)OC(=O)C(=C2O)Cc3cccc4c3cccc4
CLQ P16083 319.9 Da LogP 4.81 TPSA 28.2 ✓ Ro5 ✓ Clean CCN(CC)CCC[C@@H](C)Nc1ccnc2c1ccc(c2)Cl
DM2 P16083 543.5 Da LogP 0.00 TPSA 206.1 3 viol. Alert C[C@H]1[C@H]([C@H](C[C@@H](O1)O[C@H]2C[C@@](Cc3…
DQN P05982 164.2 Da LogP 1.81 TPSA 34.1 ✓ Ro5 Alert CC1=C(C(=O)C(=C(C1=O)C)C)C
DTC P15559 336.3 Da LogP 2.21 TPSA 86.7 ✓ Ro5 ✓ Clean c1ccc2c(c1)C(=O)C(C(=O)O2)CC3C(=O)c4ccccc4OC3=O
E09 P15559 290.3 Da LogP 0.02 TPSA 82.5 ✓ Ro5 Alert Cn1c(c(c2c1C(=O)C=C(C2=O)N3CC3)CO)CCCO
E6A P15559 413.2 Da LogP 2.50 TPSA 88.5 ✓ Ro5 Alert c1ccc2c(c1)C(=O)[C@@H]([C@H](C2=O)O)[C@@H]3[C@@…
EAW P15559 305.2 Da LogP 2.20 TPSA 49.4 ✓ Ro5 ✓ Clean c1ccc(c(c1)NS(=O)(=O)N2CCCC2)Br
ET P16083 314.4 Da LogP 4.13 TPSA 55.9 ✓ Ro5 Alert CC[n+]1c2cc(ccc2c3ccc(cc3c1c4ccccc4)N)N
EWQ P16083 233.3 Da LogP 1.86 TPSA 40.5 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1cc(cc2OC)OC)C
HGZ P16083 249.3 Da LogP 1.86 TPSA 60.6 ✓ Ro5 ✓ Clean CC1=CC(=O)Nc2c1cc(c(c2OC)OC)OC
K17 P16083 433.7 Da LogP 4.61 TPSA 28.7 ✓ Ro5 ✓ Clean c1[nH]c2c(n1)c(c(c(c2Br)Br)Br)Br
K25 P16083 476.8 Da LogP 4.68 TPSA 31.9 ✓ Ro5 ✓ Clean CN(C)c1[nH]c2c(n1)c(c(c(c2Br)Br)Br)Br
LDP P16083 153.2 Da LogP 0.60 TPSA 66.5 ✓ Ro5 Alert c1cc(c(cc1CCN)O)O
M42 P16083 203.2 Da LogP 1.57 TPSA 51.3 ✓ Ro5 ✓ Clean CC1=CC(=O)Nc2c1ccc3c2OCO3
M49 P16083 275.3 Da LogP 1.21 TPSA 87.3 ✓ Ro5 ✓ Clean CC(=O)NCC[C@@H]1c2cc(ccc2NC1=O)NC(=O)C
ML1 P16083 232.3 Da LogP 1.86 TPSA 54.1 ✓ Ro5 ✓ Clean CC(=O)NCCc1c[nH]c2c1cc(cc2)OC
ML2 P16083 358.2 Da LogP 2.46 TPSA 54.1 ✓ Ro5 ✓ Clean CC(=O)NCCc1c2cc(ccc2[nH]c1I)OC
MXX P16083 233.3 Da LogP 1.86 TPSA 40.5 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1c(ccc2OC)OC)C
MZC P16083 275.3 Da LogP 2.02 TPSA 83.2 ✓ Ro5 ✓ Clean CC(=O)NCCc1c[nH]c2c1cc(cc2)NC(=O)OC
MZX P16083 219.2 Da LogP 1.85 TPSA 51.3 ✓ Ro5 ✓ Clean CC1=CC(=O)Nc2c1c(ccc2OC)OC
O73 P16083 412.4 Da LogP 2.41 TPSA 129.5 ✓ Ro5 Alert Cc1c(c2c(n1C)C(=O)C=C(C2=O)NCCCCN)COc3ccc(cc3)[…
RH1 P15559 234.3 Da LogP -0.71 TPSA 60.4 ✓ Ro5 Alert CC1=C(C(=O)C(=C(C1=O)N2CC2)CO)N3CC3
RZW P16083 263.3 Da LogP 1.87 TPSA 49.7 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1c(c(cc2OC)OC)OC)C
STL P16083 228.2 Da LogP 2.97 TPSA 60.7 ✓ Ro5 ✓ Clean c1cc(ccc1\C=C\c2cc(cc(c2)O)O)O
TE7 P16083 336.4 Da LogP 2.42 TPSA 58.9 ✓ Ro5 ✓ Clean CN(C)CCNc1ccc2c3c1C(=O)c4cc(ccc4-n3cn2)OC
UXH P16083 291.7 Da LogP 0.74 TPSA 128.3 ✓ Ro5 ✓ Clean CN1c2c3c(cc(nc3c(c(c2N)Cl)N)C(=O)N)C1=O
V0L P16083 345.4 Da LogP 1.88 TPSA 91.6 ✓ Ro5 ✓ Clean C[C@@H](c1ccc2nccn2c1)n3c4c(ncc(n4)c5cnn(c5)C)n…
VAP P16083 263.3 Da LogP 1.87 TPSA 49.7 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1cc(c(c2OC)OC)OC)C
VK3 P16083 172.2 Da LogP 2.01 TPSA 34.1 ✓ Ro5 Alert CC1=CC(=O)c2ccccc2C1=O
VVV P16083 249.3 Da LogP 1.86 TPSA 60.6 ✓ Ro5 ✓ Clean CC1=CC(=O)Nc2c1c(c(cc2OC)OC)OC
XM5 P16083 233.2 Da LogP 1.28 TPSA 49.7 ✓ Ro5 ✓ Clean CN1c2c(ccc3c2OCO3)C(=CC1=O)OC
XRA P16083 383.4 Da LogP 1.78 TPSA 107.0 ✓ Ro5 ✓ Clean COc1cc2c(cc1OC)nc(nc2N)N3CCN(CC3)C(=O)c4ccco4
YTR P16083 233.3 Da LogP 1.86 TPSA 40.5 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1ccc(c2OC)OC)C
ZXZ P16083 173.2 Da LogP 1.85 TPSA 22.0 ✓ Ro5 ✓ Clean CC1=CC(=O)N(c2c1cccc2)C

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.