Protein profile

PA0865

4-hydroxyphenylpyruvate dioxygenase

Genome: NC_002516.2

Gene: hpd PA0865 Structure source: AlphaFold UniProt Q9I576
Amino acids 357
Annotations 7
Features 25
PDB binders 2
Druggability 0.692

Overview

Basic information about this protein and its source genome.

Accession
PA0865
Gene
hpd PA0865
Status
annotated
Amino acids
357
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
31.707
Human E-value
2.58e-34
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.692
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MNAVAKIEQHNPIGTDGFEFVEFTAPDAKGIEQLRQLFNMMGFTETAKHRSKEVFLFQQNDINIVLNGSPTGHVHEFALKHGPSACAMAFRVKNASQAAAYAESQGAKLVGSHANFGELNIPSLEGIGGSLLYLVDRYGDRSIYDVDFEFIEGRSANDNSVGLTYIDHLTHNVKRGQMDVWSGFYERIANFREIRYFDIEGKLTGLFSRAMTAPCGKIRIPINESADDTSQIEEFIREYHGEGIQHIALTTDDIYATVRKLRDNGVKFMSTPDTYYEKVDTRVAGHGEPLEQLRELNLLIDGAPGDDGILLQIFTDTVIGPIFFEIIQRKGNQGFGEGNFKALFESIEEDQIRRGVI

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0003868 Catalysis of the reaction: 4-hydroxyphenylpyruvate + O2 = homogentisate + CO2.
  • GO:0046872 Binding to a metal ion.
  • GO:0006559 The chemical reactions and pathways resulting in the breakdown of L-phenylalanine.
  • GO:0006572 The chemical reactions and pathways resulting in the breakdown of L-tyrosine.
  • GO:0016701 Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from one donor, and molecular oxygen is incorporated into a donor.
  • GO:0009072 The chemical reactions and pathways involving aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).

Sequence Features

Domain/signature hits from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
8 160 FunFam G3DSA:3.10.180.10:FF:000018 4-hydroxyphenylpyruvate dioxygenase
163 349 CDD cd07250 HPPD_C_like
163 349 InterPro IPR041735 4-hydroxyphenylpyruvate dioxygenase, C-terminal
161 357 Gene3D G3DSA:3.10.180.10 -
161 357 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
17 356 NCBIfam TIGR01263 4-hydroxyphenylpyruvate dioxygenase
17 356 InterPro IPR005956 4-hydroxyphenylpyruvate dioxygenase
1 357 PIRSF PIRSF009283 4HPP_dioxygenase
1 357 InterPro IPR005956 4-hydroxyphenylpyruvate dioxygenase
8 344 SUPERFAMILY SSF54593 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
8 344 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
165 316 ProSiteProfiles PS51819 Vicinal oxygen chelate (VOC) domain profile.
165 316 InterPro IPR037523 Vicinal oxygen chelate (VOC) domain
166 277 Pfam PF00903 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
166 277 InterPro IPR004360 Glyoxalase/fosfomycin resistance/dioxygenase domain
8 160 Gene3D G3DSA:3.10.180.10 -
8 160 InterPro IPR029068 Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase
161 357 FunFam G3DSA:3.10.180.10:FF:000007 4-hydroxyphenylpyruvate dioxygenase
18 150 CDD cd08342 HPPD_N_like
18 150 InterPro IPR041736 4-hydroxyphenylpyruvate dioxygenase, N-terminal
17 137 ProSiteProfiles PS51819 Vicinal oxygen chelate (VOC) domain profile.
17 137 InterPro IPR037523 Vicinal oxygen chelate (VOC) domain
12 355 PANTHER PTHR11959 4-HYDROXYPHENYLPYRUVATE DIOXYGENASE
12 355 InterPro IPR005956 4-hydroxyphenylpyruvate dioxygenase
10 149 Pfam PF14696 Hydroxyphenylpyruvate dioxygenase, HPPD, N-terminal

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0865
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
2 0.692
1 0.376

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

152 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
869 P32755 442.5 Da LogP 3.96 TPSA 98.5 ✓ Ro5 ✓ Clean Cc1c(ccc(c1c2ccc(cc2)OC)S(=O)(=O)C)C(=O)c3cnn(c…
EMC P80064 229.7 Da LogP 0.97 TPSA 0.0 ✓ Ro5 ✓ Clean CC[Hg+]

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.