Protein profile

PA0872

phenylalanine 4-monooxygenase

Genome: NC_002516.2

Gene: PA0872 phhA Structure source: AlphaFold UniProt P43334
Amino acids 262
Annotations 7
Features 24
PDB binders 7
Druggability 0.8

Overview

Basic information about this protein and its source genome.

Accession
PA0872
Gene
PA0872 phhA
Status
annotated
Amino acids
262
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
44.928
Human E-value
2.72e-13
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.8
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MKTTQYVARQPDDNGFIHYPETEHQVWNTLITRQLKVIEGRACQEYLDGIEQLGLPHERIPQLDEINRVLQATTGWRVARVPALIPFQTFFELLASQQFPVATFIRTPEELDYLQEPDIFHEIFGHCPLLTNPWFAEFTHTYGKLGLKASKEERVFLARLYWMTIEFGLVETDQGKRIYGGGILSSPKETVYSLSDEPLHQAFNPLEAMRTPYRIDILQPLYFVLPDLKRLFQLAQEDIMALVHEAMRLGLHAPLFPPKQAA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0005506 Binding to an iron (Fe) ion.
  • GO:0004497 Catalysis of the incorporation of one atom of molecular oxygen (O2) into the substrate and the reduction of the other atom of O2 to water.
  • GO:0004505 Catalysis of the reaction: L-phenylalanine + tetrahydrobiopterin + O2 = L-tyrosine + 4-alpha-hydroxytetrahydrobiopterin.
  • GO:0006559 The chemical reactions and pathways resulting in the breakdown of L-phenylalanine.
  • GO:0009072 The chemical reactions and pathways involving aromatic amino acid family, amino acids with aromatic ring (phenylalanine, tyrosine, tryptophan).
  • GO:0016714 Catalysis of an oxidation-reduction (redox) reaction in which hydrogen or electrons are transferred from reduced pteridine and one other donor, and one atom of oxygen is incorporated into one donor.

Sequence Features

Domain/signature hits from InterPro and related databases.

24 records
Show feature table
Start End DB Term Name
16 229 Pfam PF00351 Biopterin-dependent aromatic amino acid hydroxylase
16 229 InterPro IPR019774 Aromatic amino acid hydroxylase, C-terminal
3 248 SUPERFAMILY SSF56534 Aromatic aminoacid monoxygenases, catalytic and oligomerization domains
3 248 InterPro IPR036329 Aromatic amino acid monoxygenase, C-terminal domain superfamily
12 232 PANTHER PTHR11473 AROMATIC AMINO ACID HYDROXYLASE
12 232 InterPro IPR001273 Aromatic amino acid hydroxylase
9 254 NCBIfam TIGR01267 phenylalanine 4-monooxygenase
9 254 InterPro IPR005960 Phenylalanine-4-hydroxylase, monomeric form
1 262 ProSiteProfiles PS51410 Biopterin-dependent aromatic amino acid hydroxylase family profile.
1 262 InterPro IPR019774 Aromatic amino acid hydroxylase, C-terminal
9 233 CDD cd03348 pro_PheOH
9 233 InterPro IPR005960 Phenylalanine-4-hydroxylase, monomeric form
117 128 ProSitePatterns PS00367 Biopterin-dependent aromatic amino acid hydroxylases signature.
117 128 InterPro IPR018301 Aromatic amino acid hydroxylase, iron/copper binding site
74 96 PRINTS PR00372 Biopterin-dependent aromatic amino acid hydroxylase signature
74 96 InterPro IPR019774 Aromatic amino acid hydroxylase, C-terminal
138 157 PRINTS PR00372 Biopterin-dependent aromatic amino acid hydroxylase signature
138 157 InterPro IPR019774 Aromatic amino acid hydroxylase, C-terminal
209 228 PRINTS PR00372 Biopterin-dependent aromatic amino acid hydroxylase signature
209 228 InterPro IPR019774 Aromatic amino acid hydroxylase, C-terminal
178 196 PRINTS PR00372 Biopterin-dependent aromatic amino acid hydroxylase signature
178 196 InterPro IPR019774 Aromatic amino acid hydroxylase, C-terminal
1 262 Gene3D G3DSA:1.10.800.10 Aromatic amino acid hydroxylase
1 262 InterPro IPR036951 Aromatic amino acid hydroxylase superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA0872
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.8
2 0.29

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

58 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
DAH P00439 197.2 Da LogP 0.05 TPSA 103.8 ✓ Ro5 Alert c1cc(c(cc1C[C@@H](C(=O)O)N)O)O
H2B P00439 239.2 Da LogP -2.61 TPSA 132.7 ✓ Ro5 ✓ Clean C[C@@H]([C@@H]([C@H]1CNC2=NC(=NC(=O)C2=N1)N)O)O
HBI P00439 239.2 Da LogP -1.41 TPSA 136.6 ✓ Ro5 ✓ Clean C[C@@H]([C@@H](C1=NC2=C(NC1)N=C(NC2=O)N)O)O
LDP P00439 153.2 Da LogP 0.60 TPSA 66.5 ✓ Ro5 Alert c1cc(c(cc1CCN)O)O
LNR P00439 169.2 Da LogP 0.09 TPSA 86.7 ✓ Ro5 Alert c1cc(c(cc1[C@H](CN)O)O)O
PIN Q54XS1 302.4 Da LogP -1.62 TPSA 115.2 ✓ Ro5 ✓ Clean C1CN(CCN1CCS(=O)(=O)O)CCS(=O)(=O)O
XDE P00439 183.2 Da LogP 0.35 TPSA 72.7 ✓ Ro5 Alert CNC[C@H](c1ccc(c(c1)O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.