Overview
Basic information about this protein and its source genome.
- Accession
- PA0880
- Gene
- PA0880
- Status
- annotated
- Amino acids
- 126
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- hit
- Human identity (%)
- 57.377
- Human E-value
- 7.51e-49
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MQIDRLDHLVLTVRDIDASIDFYTRVLGMRAVTFGAGRKALAFGAQKINLHQAGGEFEPKAERPTPGSADLCFIVATPLEAVAEQLRQQAVEILEGPVQRTGAGGPILSLYLRDPDLNLIELSNPL
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0051213 Catalysis of the incorporation of both atoms of molecular oxygen (O2) into the substrate.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 124 | SUPERFAMILY | SSF54593 | Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase |
| 1 | 124 | InterPro | IPR029068 | Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase |
| 7 | 125 | Gene3D | G3DSA:3.10.180.10 | - |
| 7 | 125 | InterPro | IPR029068 | Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase |
| 3 | 125 | CDD | cd07253 | GLOD5 |
| 5 | 125 | ProSiteProfiles | PS51819 | Vicinal oxygen chelate (VOC) domain profile. |
| 5 | 125 | InterPro | IPR037523 | Vicinal oxygen chelate (VOC) domain |
| 5 | 122 | Pfam | PF00903 | Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily |
| 5 | 122 | InterPro | IPR004360 | Glyoxalase/fosfomycin resistance/dioxygenase domain |
| 1 | 123 | PANTHER | PTHR21366 | GLYOXALASE FAMILY PROTEIN |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0880
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.662 | ||||||
| 2 | 0.515 |