Protein profile
PA0896
arginine N-succinyltransferase subunit alpha
Genome: NC_002516.2
Overview
Basic information about this protein and its source genome.
- Accession
- PA0896
- Gene
- astA PA0896 aruF
- Status
- annotated
- Amino acids
- 338
- Structure source
- Experimental + AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MLVMRPAQAADLPQVQRLAADSPVGVTSLPDDAERLRDKILASEASFAAEVSYNGEESYFFVLEDSASGELVGCSAIVASAGFSEPFYSFRNETFVHASRSLSIHNKIHVLSLCHDLTGNSLLTSFYVQRDLVQSVYAELNSRGRLLFMASHPERFADAVVVEIVGYSDEQGESPFWNAVGRNFFDLNYIEAEKLSGLKSRTFLAELMPHYPIYVPLLPDAAQESMGQVHPRAQITFDILMREGFETDNYIDIFDGGPTLHARTSGIRSIAQSRVVPVKIGEAPKSGRPYLVTNGQLQDFRAVVLDLDWAPGKPVALSVEAAEALGVGEGASVRLVAV
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Enzyme Commission (EC)
1Gene Ontology (GO)
4- GO:0008791 Catalysis of the reaction: succinyl-CoA + L-arginine = N2-succinyl-L-arginine + CoA + H+.
- GO:0009015 Catalysis of the reaction: N(2)-succinyl-L-arginine + 2 H2O + 2 H+ = N(2)-succinyl-L-ornithine + CO2 + 2 NH4.
- GO:0006527 The chemical reactions and pathways resulting in the breakdown of L-arginine.
- GO:0019545 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including succinate.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 1 | 337 | PANTHER | PTHR30420 | N-SUCCINYLARGININE DIHYDROLASE |
| 3 | 337 | NCBIfam | TIGR03243 | arginine and ornithine succinyltransferase subunits |
| 3 | 337 | InterPro | IPR007041 | Arginine N-succinyltransferase AstA/AruG |
| 1 | 337 | SUPERFAMILY | SSF55729 | Acyl-CoA N-acyltransferases (Nat) |
| 1 | 337 | InterPro | IPR016181 | Acyl-CoA N-acyltransferase |
| 274 | 338 | Gene3D | G3DSA:2.40.40.20 | - |
| 1 | 336 | Pfam | PF04958 | Arginine N-succinyltransferase beta subunit |
| 1 | 336 | InterPro | IPR007041 | Arginine N-succinyltransferase AstA/AruG |
| 3 | 338 | NCBIfam | TIGR03245 | arginine/ornithine succinyltransferase subunit alpha |
| 3 | 338 | InterPro | IPR017651 | Arginine/ornithine succinyltransferase, alpha subunit |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
1 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.685 | ||||||
| 4 | 0.377 |
Pockets (P2RANK)
Showing top-ranked P2Rank candidates by probability. Probability is color-coded per P2Rank calibration: high (≥ 0.5), medium (0.2 – 0.49), low (< 0.2).
| P2RANK | Sticks | Spheres | Surfaces | Score | Probability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|---|
| 1 | 26.3 | 0.912 | ||||||
| 2 | 5.91 | 0.289 | ||||||
| 3 | 4.62 | 0.2 | ||||||
| 4 | 3.39 | 0.122 | ||||||
| 5 | 1.8 | 0.034 |
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 6 | 0.739 | ||||||
| 1 | 0.695 |