Protein profile

PA0899

N-succinylarginine dihydrolase

Genome: NC_002516.2

Gene: aruB PA0899 astB Structure source: AlphaFold UniProt O50175

Export view

Amino acids 448

Annotations 6

Features 10

PDB binders 2

Druggability 0.719

Overview

Basic information about this protein and its source genome.

Accession: PA0899
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: aruB PA0899 astB
Status: annotated
Amino acids: 448
Structure source: AlphaFold

3.5.3.23

GO:0009015 Catalysis of the reaction: N(2)-succinyl-L-arginine + 2 H2O + 2 H+ = N(2)-succinyl-L-ornithine + CO2 + 2 NH4. GO:0006527 The chemical reactions and pathways resulting in the breakdown of L-arginine. GO:0019544 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including L-glutamate. GO:0019545 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including succinate. GO:0006525 The chemical reactions and pathways involving arginine, 2-amino-5-(carbamimidamido)pentanoic acid.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.719

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MNAHEVNFDGLVGPTHNYGGLSYGNVASQSNSQAVSNPKEAAKQGLAKMKALMEMGFKQGVLAPQARPDTAALRSLGFSGSDEEVIRRAAKEAMPLLAACSSASSMWTANAATVSPSADTADGRVHFTAANLNCKFHRSIEHPTTSRVLAAMFNDERHFAHHAALPAVSQFGDEGAANHTRFCKDYGDAGVEFFVFGRSAFDSRFPAPQRYPARQTLEACQAVARLHGLSEAGVVYAQQNPAVIDQGVFHNDVISVGNGEVLFHHEDAFLDTEKVLAELHDKLGRRGGRFRAICVPRDQVAVEDAVKSYLFNSQLLSKADGSMLLVVPEECRNNPRVWNYLDQLTGDDGPIREVKVFDLKQSMQNGGGPACLRLRVALQERELAAVNPGVIMSAGLYDTLVAWVDRHYRDRLSETDLADPQLLLECRTALDELTQILKLGSVYSFQLD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 5 GO

Enzyme Commission (EC)

3.5.3.23

Gene Ontology (GO)

GO:0009015 Catalysis of the reaction: N(2)-succinyl-L-arginine + 2 H2O + 2 H+ = N(2)-succinyl-L-ornithine + CO2 + 2 NH4.
GO:0006527 The chemical reactions and pathways resulting in the breakdown of L-arginine.
GO:0019544 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including L-glutamate.
GO:0019545 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including succinate.
GO:0006525 The chemical reactions and pathways involving arginine, 2-amino-5-(carbamimidamido)pentanoic acid.

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records

Show feature table

Start	End	DB	Term	Name
1	448	FunFam	G3DSA:3.75.10.20:FF:000001	N-succinylarginine dihydrolase
3	446	NCBIfam	TIGR03241	N-succinylarginine dihydrolase
3	446	InterPro	IPR007079	Succinylarginine dihydrolase
3	446	SUPERFAMILY	SSF55909	Pentein
1	448	Gene3D	G3DSA:3.75.10.20	Succinylarginine dihydrolase
1	448	InterPro	IPR037031	Succinylarginine dihydrolase superfamily
1	447	PANTHER	PTHR30420	N-SUCCINYLARGININE DIHYDROLASE
3	446	Pfam	PF04996	Succinylarginine dihydrolase
1	447	Hamap	MF_01172	N-succinylarginine dihydrolase [astB].
1	447	InterPro	IPR007079	Succinylarginine dihydrolase

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0899	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.719

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

52 records

Highest-confidence structural evidence: ligands co-crystallized with this exact protein. If the source PDB is loaded in TPW, use Open crystal to inspect it in the structure viewer.

No PDB structure with a co-crystallized ligand found for this exact protein.

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Ligand	Source crystal	UniProt (homolog)	MW · LogP · TPSA	Lipinski	PAINS	SMILES
SUG	1YNI	P76216	274.3 Da LogP -1.32 TPSA 165.6	1 viol.	✓ Clean	`C(C[C@@H](C(=O)O)NC(=O)CCC(=O)O)CNC(=N)N`
SUO	1YNH	P76216	232.2 Da LogP -0.84 TPSA 129.7	✓ Ro5	✓ Clean	`C(C[C@@H](C(=O)O)NC(=O)CCC(=O)O)CN`

Experimental bioactivity from ChEMBL measured directly on this protein. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL bioactivity data found for this exact protein.

Bioactivity inferred from similar proteins in ChEMBL. Score = pchembl (−log Ki/IC₅₀; higher = more potent).

No ChEMBL hits found through similar proteins.

Proposed virtual-screening candidates from ZINC. Score = Tanimoto similarity to a known binder (0–1; higher = more similar).

Ligand	Tanimoto	MW · LogP · TPSA	Lipinski	PAINS	SMILES
ZINC1529628	1.000	274.3 Da LogP -1.32 TPSA 165.6	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NC(=O)CCC(=O)O)C(=O)O`
ZINC2383349774	0.838	330.4 Da LogP 0.24 TPSA 165.6	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NC(=O)CCCCCCC(=O)O)C(=O)O`
ZINC1866114950	0.758	260.3 Da LogP -0.06 TPSA 129.7	✓ Ro5	✓ Clean	`NCCCC[C@H](NC(=O)CCCC(=O)O)C(=O)O`
ZINC15261332	0.744	303.3 Da LogP -1.99 TPSA 191.6	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O`
ZINC1576211	0.730	231.3 Da LogP -2.22 TPSA 154.3	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NC(=O)CN)C(=O)O`
ZINC1530138	0.719	217.3 Da LogP -0.97 TPSA 118.4	✓ Ro5	✓ Clean	`NCCCC[C@H](NC(=O)CCN)C(=O)O`
ZINC100008960	0.707	356.5 Da LogP 2.74 TPSA 128.3	✓ Ro5	✓ Clean	`CCCCCCCCCCCC(=O)N[C@H](CCCNC(=N)N)C(=O)O`
ZINC70669861	0.707	356.5 Da LogP 2.74 TPSA 128.3	✓ Ro5	✓ Clean	`CCCCCCCCCCCC(=O)N[C@@H](CCCNC(=N)N)C(=O)O`
ZINC85738396	0.707	384.6 Da LogP 3.52 TPSA 128.3	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCC(=O)N[C@@H](CCCNC(=N)N)C(=O)O`
ZINC15261541	0.706	261.3 Da LogP -1.51 TPSA 155.7	✓ Ro5	✓ Clean	`NCCC[C@H](NC(=O)CC[C@H](N)C(=O)O)C(=O)O`
ZINC1847640	0.703	216.2 Da LogP -1.16 TPSA 128.3	✓ Ro5	✓ Clean	`CC(=O)N[C@@H](CCCNC(=N)N)C(=O)O`
ZINC2169795	0.703	216.2 Da LogP -1.16 TPSA 128.3	✓ Ro5	✓ Clean	`CC(=O)N[C@H](CCCNC(=N)N)C(=O)O`
ZINC1530296	0.700	247.2 Da LogP -0.71 TPSA 141.0	✓ Ro5	✓ Clean	`O=C(O)CCC(=O)N[C@@H](CCC(=O)O)C(=O)O`
ZINC6783254	0.697	231.2 Da LogP 0.61 TPSA 103.7	✓ Ro5	✓ Clean	`CCCC[C@H](NC(=O)CCC(=O)O)C(=O)O`
ZINC6783285	0.697	231.2 Da LogP 0.61 TPSA 103.7	✓ Ro5	✓ Clean	`CCCC[C@@H](NC(=O)CCC(=O)O)C(=O)O`
ZINC1722125	0.694	217.2 Da LogP -1.63 TPSA 154.3	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NC(N)=O)C(=O)O`
ZINC4537126	0.694	217.2 Da LogP -1.63 TPSA 154.3	1 viol.	✓ Clean	`N=C(N)NCCC[C@@H](NC(N)=O)C(=O)O`
ZINC1529261	0.684	304.3 Da LogP -1.39 TPSA 185.8	1 viol.	✓ Clean	`N=C(N)NCCC[C@@H](N[C@@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC1529262	0.684	304.3 Da LogP -1.39 TPSA 185.8	1 viol.	✓ Clean	`N=C(N)NCCC[C@@H](N[C@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC1529939	0.684	304.3 Da LogP -1.39 TPSA 185.8	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](N[C@@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC1529940	0.684	304.3 Da LogP -1.39 TPSA 185.8	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](N[C@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC1530510	0.684	246.3 Da LogP -1.23 TPSA 148.5	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NCCC(=O)O)C(=O)O`
ZINC141957116	0.667	342.5 Da LogP 4.00 TPSA 92.4	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCC(=O)N[C@@H](CCCN)C(=O)O`
ZINC58123315	0.667	376.3 Da LogP -1.36 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@H](NC(=O)CCC(=O)N[C@@H](CCC(=O)O)C(=…`
ZINC58123320	0.667	376.3 Da LogP -1.36 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@H](NC(=O)CCC(=O)N[C@H](CCC(=O)O)C(=O…`
ZINC58123326	0.667	376.3 Da LogP -1.36 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@@H](NC(=O)CCC(=O)N[C@H](CCC(=O)O)C(=…`
ZINC78044048	0.667	342.5 Da LogP 4.00 TPSA 92.4	✓ Ro5	✓ Clean	`CCCCCCCCCCCCCC(=O)N[C@H](CCCN)C(=O)O`
ZINC1576188	0.659	288.3 Da LogP -3.11 TPSA 183.4	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](NC(=O)CNC(=O)CN)C(=O)O`
ZINC5502067	0.659	288.3 Da LogP -3.11 TPSA 183.4	1 viol.	✓ Clean	`N=C(N)NCCC[C@@H](NC(=O)CNC(=O)CN)C(=O)O`
ZINC39798595	0.644	360.4 Da LogP -2.87 TPSA 220.7	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)…`
ZINC1731788	0.643	303.3 Da LogP -1.99 TPSA 191.6	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O`
ZINC1731789	0.643	303.3 Da LogP -1.99 TPSA 191.6	1 viol.	✓ Clean	`N=C(N)NCCC[C@@H](N)C(=O)N[C@@H](CCC(=O)O)C(=O)O`
ZINC5113904	0.639	261.3 Da LogP -1.51 TPSA 155.7	✓ Ro5	✓ Clean	`NCCC[C@H](NC(=O)[C@@H](N)CCC(=O)O)C(=O)O`
ZINC147300883	0.636	217.2 Da LogP 0.22 TPSA 103.7	✓ Ro5	✓ Clean	`CCC[C@@H](NC(=O)CCC(=O)O)C(=O)O`
ZINC24803120	0.636	217.2 Da LogP 0.22 TPSA 103.7	✓ Ro5	✓ Clean	`CCC[C@H](NC(=O)CCC(=O)O)C(=O)O`
ZINC116981435	0.629	319.3 Da LogP -0.81 TPSA 179.0	1 viol.	✓ Clean	`NCCCC[C@@H](NC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC116981437	0.629	319.3 Da LogP -0.81 TPSA 179.0	1 viol.	✓ Clean	`NCCCC[C@@H](NC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC116981440	0.629	319.3 Da LogP -0.81 TPSA 179.0	1 viol.	✓ Clean	`NCCCC[C@H](NC(=O)N[C@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC40860752	0.629	319.3 Da LogP -0.81 TPSA 179.0	1 viol.	✓ Clean	`NCCCC[C@H](NC(=O)N[C@@H](CCC(=O)O)C(=O)O)C(=O)O`
ZINC225926188	0.625	404.4 Da LogP -0.58 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@H](NC(=O)CCCCC(=O)N[C@@H](CCC(=O)O)C…`
ZINC225926203	0.625	404.4 Da LogP -0.58 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@H](NC(=O)CCCCC(=O)N[C@H](CCC(=O)O)C(…`
ZINC225926220	0.625	404.4 Da LogP -0.58 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@@H](NC(=O)CCCCC(=O)N[C@H](CCC(=O)O)C…`
ZINC225956936	0.625	390.3 Da LogP -0.97 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@H](NC(=O)CCCC(=O)N[C@@H](CCC(=O)O)C(…`
ZINC225956945	0.625	390.3 Da LogP -0.97 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@H](NC(=O)CCCC(=O)N[C@H](CCC(=O)O)C(=…`
ZINC225956959	0.625	390.3 Da LogP -0.97 TPSA 207.4	1 viol.	✓ Clean	`O=C(O)CC[C@@H](NC(=O)CCCC(=O)N[C@H](CCC(=O)O)C(…`
ZINC5706877	0.625	330.4 Da LogP -2.59 TPSA 216.2	1 viol.	✓ Clean	`N=C(N)NCCC[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O`
ZINC13514809	0.622	404.4 Da LogP -1.77 TPSA 222.1	1 viol.	✓ Clean	`NCCCC[C@H](NC(=O)CC[C@H](NC(=O)CC[C@H](N)C(=O)O…`
ZINC2579085	0.610	245.3 Da LogP -1.83 TPSA 154.3	1 viol.	✓ Clean	`C[C@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O`
ZINC8577164	0.610	245.3 Da LogP -1.83 TPSA 154.3	1 viol.	✓ Clean	`C[C@@H](N)C(=O)N[C@@H](CCCNC(=N)N)C(=O)O`
ZINC1857792174	0.609	374.4 Da LogP -0.99 TPSA 187.9	1 viol.	✓ Clean	`CC(C)[C@@H](NC(=O)CCC(=O)O)C(=O)N[C@@H](CCCNC(N…`

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.