Protein target profile

PA0901

succinylglutamate desuccinylase

Genome: NC_002516.2

Gene: PA0901 aruE astE 3D evidence: AlphaFold DB model UniProt O50177
Export view
Length 332
Pocket druggability 0.715
EC / GO 1 / 7
Target summary

Target candidate with partial support; inspect missing evidence before prioritizing.

4 signals

Strengths

No similar human protein detected The current BLAST sequence screen did not find a significant human match, lowering apparent off-target risk. Strong predicted binding pocket FPocket selected-pocket score 0.71. This is a computational pocket signal, not binding validation. Structure available AlphaFold DB model

Risks / watch

No major risk signal surfaced in the loaded evidence.

Missing evidence

No metabolic context No SBML/network-derived reaction evidence is loaded for this protein. No ligand evidence No experimental PDB ligands, measured ChEMBL bioactivity, or proposed ZINC compound records are available.
How to read this page

PDB: experimentally determined structures from the Protein Data Bank. These are the strongest structural evidence, but may cover only part of the protein.

AlphaFold DB model: a precomputed predicted structure downloaded from AlphaFold Database/UniProt, not an experiment performed here.

ColabFold model: a predicted structure generated for this workspace; interpret it with coverage and confidence.

pLDDT: confidence score for predicted structures. High values support local geometry; low values mean the region should not drive pocket interpretation.

FPocket / P2Rank: software tools that predict possible ligand-binding pockets on a 3D structure. They are useful screening signals, not experimental validation.

Druggability: a pocket-based estimate of whether a small molecule could bind productively. It does not mean a drug already exists.

PDB ligand: a compound observed in an experimental structure. Direct same-protein records are stronger than homolog-transferred records.

ChEMBL: a public database of measured compound bioactivity. Direct entries are stronger than entries transferred from similar proteins.

ZINC: a purchasable-compound database. Here it marks proposed candidates from chemical similarity, not measured binders.

LigQ / LigQ_2: an internal TPW pipeline step that gathers PDB, ChEMBL, and ZINC ligand evidence for each protein.

Off-target: sequence similarity to proteins we prefer not to hit, such as human proteins or beneficial gut microbiome proteins.

DEG: Database of Essential Genes. A match suggests the protein resembles genes known to be essential in other organisms.

Roary / CoreCruncher: pan-genome tools used to decide whether a gene is core across analyzed strains or accessory/strain-specific.

EC / GO: functional annotations: EC describes enzyme reactions; GO describes biological process, molecular function, or cellular component.

KEGG pathway: a curated metabolic route label used here to group reactions imported from the metabolic model.

Chokepoint: a metabolic reaction that is the only producer or consumer of a metabolite in the imported model.

Overview

Basic information about this protein and its source genome.

Accession
PA0901
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA0901 aruE astE
Status
annotated
Amino acids
332
3D evidence
AlphaFold DB model
EC
3.5.1.96
GO
GO:0016811 Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amide. GO:0016788 Catalysis of the hydrolysis of any ester bond. GO:0009017 Catalysis of the reaction: N-succinyl-L-glutamate + H2O = L-glutamate + succinate. GO:0008270 Binding to a zinc ion (Zn). GO:0006527 The chemical reactions and pathways resulting in the breakdown of L-arginine. GO:0019544 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including L-glutamate.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
Hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected pocket evidence

The selected pocket score is the FPocket value used for ranking after applying the curated structure priority. It estimates small-molecule pocket quality; it is not experimental binding evidence. The 3D viewer may show a different loaded structure, so visible pockets can differ.

FPocket 0.715
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MLALGKLLDLTLAGREPTEKIQLTADGTRLHWLAEGALEVTPIGARDNGVDLLLSAGIHGNETAPIELLERLIRKVAAGTLKPAARVLFLFGNPEAIRRGERYVEQDMNRLFNGRHEEGSGNEAFRAAELERLAQVFFSKTERVHLHYDLHTAIRGSKIEQFALYPWAEGRQHSRSELARLRDAGIEAVLLQNKPGITFSAYTYGQLGAEAFTLELGKARPFGENQEVNLERLERSLELLIDGSEEQPDGSRLDGLKLFSVSREVIKHSDHFRLHLDDDVANFTELSPGYLLAEDIGGTRWVVDEVGARIIFPNPRVKNGLRAGILVVPAKL

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 7 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

7
  • GO:0016811 Catalysis of the hydrolysis of any non-peptide carbon-nitrogen bond in a linear amide.
  • GO:0016788 Catalysis of the hydrolysis of any ester bond.
  • GO:0009017 Catalysis of the reaction: N-succinyl-L-glutamate + H2O = L-glutamate + succinate.
  • GO:0008270 Binding to a zinc ion (Zn).
  • GO:0006527 The chemical reactions and pathways resulting in the breakdown of L-arginine.
  • GO:0019544 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including L-glutamate.
  • GO:0019545 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of L-arginine into other compounds, including succinate.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
7 243 CDD cd03855 M14_ASTE
7 243 InterPro IPR016681 Succinylglutamate desuccinylase
4 331 FunFam G3DSA:3.40.630.10:FF:000017 Succinylglutamate desuccinylase
1 332 PIRSF PIRSF017020 ASTE
1 332 InterPro IPR016681 Succinylglutamate desuccinylase
28 327 PANTHER PTHR15162 ASPARTOACYLASE
6 328 NCBIfam TIGR03242 succinylglutamate desuccinylase
6 328 InterPro IPR016681 Succinylglutamate desuccinylase
6 329 SUPERFAMILY SSF53187 Zn-dependent exopeptidases
5 332 Gene3D G3DSA:3.40.630.10 Zn peptidases
49 330 Pfam PF04952 Succinylglutamate desuccinylase / Aspartoacylase family
49 330 InterPro IPR007036 Succinylglutamate desuccinylase/aspartoacylase
1 332 Hamap MF_00767 Succinylglutamate desuccinylase [astE].

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; AlphaFold DB and ColabFold models typically cover the full protein but remain computational predictions.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries plus predicted AlphaFold DB or ColabFold models. Click Switch to display a different loaded structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold DB PA0901
AlphaFold DB — — full sequence — Viewing
Pocket details Inspect a specific pocket, or open the full viewer

Binding pockets · FPocket

Druggability: high ≥ 0.7 · medium 0.4–0.69 · low < 0.4

Site 1 FPocket #1
0.498
Show in viewer