Protein profile

PA0905

carbon storage regulator

Genome: NC_002516.2

Gene: csrA rsmA PA0905 Structure source: Experimental + AlphaFold UniProt O69078
Export view
Amino acids 61
Annotations 12
Features 13
PDB binders 0
Druggability 0.563

Overview

Basic information about this protein and its source genome.

Accession
PA0905
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
csrA rsmA PA0905
Status
annotated
Amino acids
61
Structure source
Experimental + AlphaFold
GO
GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0048027 Binding to an mRNA molecule at its 5' untranslated region. GO:0006402 The chemical reactions and pathways resulting in the breakdown of mRNA, messenger RNA, which is responsible for carrying the coded genetic 'message', transcribed from DNA, to sites of protein assembly at the ribosomes. GO:0045947 Any process that stops, prevents, or reduces the frequency, rate or extent of translational initiation. GO:0045948 Any process that activates or increases the frequency, rate or extent of translational initiation. GO:0030254 The process in which proteins are transferred into the extracellular milieu or directly into host cells by the bacterial type III secretion system; secretion occurs in a continuous process without the distinct presence of periplasmic intermediates and does not involve proteolytic processing of secreted proteins.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.563
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQRIQKEKDQEPNH

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

12 GO

Gene Ontology (GO)

12
  • GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
  • GO:0048027 Binding to an mRNA molecule at its 5' untranslated region.
  • GO:0006402 The chemical reactions and pathways resulting in the breakdown of mRNA, messenger RNA, which is responsible for carrying the coded genetic 'message', transcribed from DNA, to sites of protein assembly at the ribosomes.
  • GO:0045947 Any process that stops, prevents, or reduces the frequency, rate or extent of translational initiation.
  • GO:0045948 Any process that activates or increases the frequency, rate or extent of translational initiation.
  • GO:0030254 The process in which proteins are transferred into the extracellular milieu or directly into host cells by the bacterial type III secretion system; secretion occurs in a continuous process without the distinct presence of periplasmic intermediates and does not involve proteolytic processing of secreted proteins.
  • GO:0033103 The process in which proteins are transferred into the extracellular milieu or directly into host cells by the type VI secretion system. Proteins secreted by this system do not require an N-terminal signal sequence.
  • GO:0009372 The cell-cell signaling process in which single-celled organisms carry out coordinated responses by monitoring their own population density, and often also that of other microbes, by producing small, diffusible, signal molecules, detecting the concentration of these molecules, and triggering a signal transduction pathway when a certain threshold is reached. Quorum sensing can occur amongst microbial communities in the environment or within host organisms.
  • GO:0006109 Any process that modulates the frequency, rate or extent of the chemical reactions and pathways involving carbohydrates.
  • GO:0043455 Any process that modulates the frequency, rate or extent of secondary metabolism, the chemical reactions and pathways involving compounds that are not necessarily required for growth and maintenance of cells, and are often unique to a taxon.
  • GO:1900190 Any process that modulates the frequency, rate or extent of single-species biofilm formation.
  • GO:0003723 Binding to an RNA molecule or a portion thereof.

Sequence Features

Domain/signature hits from InterPro and related databases.

13 records
Show feature table
Start End DB Term Name
1 57 NCBIfam TIGR00202 carbon storage regulator CsrA
1 57 InterPro IPR003751 Translational regulator CsrA
1 59 PANTHER PTHR34984 CARBON STORAGE REGULATOR
1 59 InterPro IPR003751 Translational regulator CsrA
1 54 SUPERFAMILY SSF117130 CsrA-like
1 54 InterPro IPR036107 Carbon storage regulator superfamily
1 61 Gene3D G3DSA:2.60.40.4380 Translational regulator CsrA
1 61 InterPro IPR036107 Carbon storage regulator superfamily
1 60 FunFam G3DSA:2.60.40.4380:FF:000001 Translational regulator CsrA
1 53 Pfam PF02599 Global regulator protein family
1 53 InterPro IPR003751 Translational regulator CsrA
1 60 Hamap MF_00167 Translational regulator CsrA [csrA].
1 60 InterPro IPR003751 Translational regulator CsrA

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

1 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
PDB 1VPZ
X-ray 2.05 Å A,B
100.0% 1-61
PDBe RCSB PDBj File
Viewing
AlphaFold PA0905
AlphaFold — — full sequence — Loaded
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer