Overview
Basic information about this protein and its source genome.
- Accession
- PA0957
- Gene
- PA0957
- Status
- annotated
- Amino acids
- 135
- Structure source
- AlphaFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- Y
- Localization
- Cytoplasmic
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MNAAQVQALIRMGLPMAEDIDFRVERLDERHALARIPFHGKLVRPGGTLSGPTIMALADAAMYAVILGRLGAVEMAVTSNLNINFLSKPRPEDLLAEASILKLGRRQVVCEVGVFSQSNEEDLVAHVTGTYALPL
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
2- GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
- GO:0061522 Catalysis of the reaction 1,4-dihydroxy-2-naphthoyl-CoA + H2O = 1,4-dihydroxy-2-naphthoate + CoA + H+.
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 16 | 132 | NCBIfam | TIGR00369 | hotdog fold thioesterase |
| 2 | 133 | SUPERFAMILY | SSF54637 | Thioesterase/thiol ester dehydrase-isomerase |
| 2 | 133 | InterPro | IPR029069 | HotDog domain superfamily |
| 46 | 120 | Pfam | PF03061 | Thioesterase superfamily |
| 46 | 120 | InterPro | IPR006683 | Thioesterase domain |
| 3 | 134 | Gene3D | G3DSA:3.10.129.10 | Hotdog Thioesterase |
| 20 | 133 | CDD | cd03443 | PaaI_thioesterase |
| 3 | 135 | FunFam | G3DSA:3.10.129.10:FF:000052 | PaaI family thioesterase |
| 16 | 132 | InterPro | IPR003736 | Phenylacetic acid degradation-related domain |
| 17 | 131 | PANTHER | PTHR43240 | 1,4-DIHYDROXY-2-NAPHTHOYL-COA THIOESTERASE 1 |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
AlphaFold
PA0957
|
AlphaFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 1 | 0.644 | ||||||
| 3 | 0.641 |