Target Pathogen

Overview

Basic information about this protein and its source genome.

Accession: PA0964
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA0964 pmpR
Status: annotated
Amino acids: 248
Structure source: AlphaFold

GO

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes. GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid). GO:0071281 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus. GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Target profile

Computed evidence for target prioritization.

Human off-target: hit
Human identity (%): 27.935
Human E-value: 4.29e-26
Gut microbiome off-target: hit
Essential (DEG): Y
Localization: Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.698

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAARQGGGVPADNPRLRLAVDKALTANMTRDTIDRAIARGVGSNDADNMVELSYEGYAPSGVAIIVEAMTDNRNRTAAEVRHAFSKCGGNLGTDGSVAYMFERKGQISFAPGVDEEALMDAALEAGADDVVVNDDGSIDVFTTFADFISVNEALAAAGFKGDEAEVTMIPSTTATLDLETAQKVLKLIDMLEDLDDVQNVYSNADIPDDVMAQLG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4

GO:0005829 The part of the cytoplasm that does not contain organelles but which does contain other particulate matter, such as protein complexes.
GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
GO:0071281 Any process that results in a change in state or activity of a cell (in terms of movement, secretion, enzyme production, gene expression, etc.) as a result of an iron ion stimulus.
GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

17 records

Show feature table

Start	End	DB	Term	Name
130	205	FunFam	G3DSA:3.30.70.980:FF:000002	Probable transcriptional regulatory protein YebC
5	237	Pfam	PF01709	Transcriptional regulator
5	237	InterPro	IPR002876	Transcriptional regulator TACO1-like
3	246	SUPERFAMILY	SSF75625	YebC-like
3	246	InterPro	IPR029072	YebC-like
3	239	Hamap	MF_00693	Probable transcriptional regulatory protein YebC [yebC].
3	239	InterPro	IPR002876	Transcriptional regulator TACO1-like
135	205	Gene3D	G3DSA:3.30.70.980	-
135	205	InterPro	IPR026564	Transcriptional regulator TACO1-like, domain 3
1	81	Gene3D	G3DSA:1.10.10.200	-
1	81	InterPro	IPR017856	Integrase-like, N-terminal
1	237	PANTHER	PTHR12532	UNCHARACTERIZED
1	237	InterPro	IPR002876	Transcriptional regulator TACO1-like
83	248	Gene3D	G3DSA:3.30.70.980	-
83	248	InterPro	IPR026564	Transcriptional regulator TACO1-like, domain 3
1	81	FunFam	G3DSA:1.10.10.200:FF:000001	Probable transcriptional regulatory protein YebC
1	237	NCBIfam	TIGR01033	YebC/PmpR family DNA-binding transcriptional regulator

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA0964	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.698

PA0964