Protein profile

PA1036

hypothetical protein

Genome: NC_002516.2

Gene: PA1036 Structure source: AlphaFold UniProt Q9I4T8

Export view

Amino acids 186

Annotations 2

Features 3

PDB binders 0

Druggability 0.75

Overview

Basic information about this protein and its source genome.

Accession: PA1036
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1036
Status: annotated
Amino acids: 186
Structure source: AlphaFold

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins. GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.75

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MSRFEIAFSGQLVAGARPEVVKANLAKLFQADAQRIELLFSGRRVVIKNNLDAASAEKYRSVLERAGAIAVVAEMEVEEVVMAPPPAQTTPVEAPQTRAATGTSAPAGRLQVAPRDGYMAAFAEVDAPDFGLAPVGADLQDAKAEAEAPKLDLSRFSVAPVGSDMGQARSEPAAPAPDTSHLRLQD

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

2 GO

Gene Ontology (GO)

GO:0005886 The membrane surrounding a cell that separates the cell from its external environment. It consists of a phospholipid bilayer and associated proteins.
GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.

Sequence Features

Domain/signature hits from InterPro and related databases.

3 records

Show feature table

Start	End	DB	Term	Name
3	185	PANTHER	PTHR34980	INNER MEMBRANE PROTEIN-RELATED-RELATED
3	185	InterPro	IPR008523	Protein of unknown function DUF805
143	186	MobiDBLite	mobidb-lite	consensus disorder prediction

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1036	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
1				0.75