Protein profile

PA1085

peptidoglycan hydrolase FlgJ

Genome: NC_002516.2

Gene: PA1085 flgJ Structure source: AlphaFold UniProt Q9I4P4
Export view
Amino acids 400
Annotations 7
Features 16
PDB binders 0
Druggability 0.691

Overview

Basic information about this protein and its source genome.

Accession
PA1085
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
PA1085 flgJ
Status
annotated
Amino acids
400
Structure source
AlphaFold
EC
3.2.1.-
GO
GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria). GO:0004040 Catalysis of the reaction: a monocarboxylic acid amide + H2O = a monocarboxylate + NH4+. GO:0016798 Catalysis of the hydrolysis of any glycosyl bond. GO:0044780 The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility. GO:0071973 Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope. GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Periplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.691
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MDSRLLSGIGAGPDSGSYTDLNRLNQLKVGKDRDGEANIRKVAQEFESLFLNEMLKSMRSANEALGDGNFMNSQTTKQYQDMYDQQLSVSLSKNAGGIGLADVLVRQLSKMKQGSRGNGENPFARVAENGAGRWPSNPSAQAGKALPMPEAGRDDSKLLNQRRLALPGKLAERMLAGIVPSASPAASQMQSLGQDSYLPAQSYPAASRRGFSTDGVDSQGSRRIAQPPLARGKSMFASADEFIATMLPMAQKAAERIGVDARYLVAQAALETGWGKSIIRQQDGGSSHNLFGIKTGSRWDGASARALTTEYEGGKAVKEIAAFRSYSSFEQSFHDYVSFLQGNDRYQNALDSAANPERFMQELQRAGYATDPQYARKVAQIARQMQTYQAVAAAGTPPLG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 EC 6 GO

Enzyme Commission (EC)

1

Gene Ontology (GO)

6
  • GO:0042597 The region between the inner (cytoplasmic) and outer membrane (Gram-negative Bacteria) or cytoplasmic membrane and cell wall (Fungi and Gram-positive Bacteria).
  • GO:0004040 Catalysis of the reaction: a monocarboxylic acid amide + H2O = a monocarboxylate + NH4+.
  • GO:0016798 Catalysis of the hydrolysis of any glycosyl bond.
  • GO:0044780 The assembly of a bacterial-type flagellum, a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope which functions in cell motility.
  • GO:0071973 Cell motility due to the motion of one or more bacterial-type flagella. A bacterial-type flagellum is a motor complex composed of an extracellular helical protein filament coupled to a rotary motor embedded in the cell envelope.
  • GO:0071555 A process that results in the assembly, arrangement of constituent parts, or disassembly of the cell wall, the rigid or semi-rigid envelope lying outside the cell membrane of plant, fungal and most prokaryotic cells, maintaining their shape and protecting them from osmotic lysis.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
276 327 FunFam G3DSA:2.10.70.40:FF:000001 Flagellar assembly peptidoglycan hydrolase FlgJ
276 327 Gene3D G3DSA:2.10.70.40 peptidoglycan hydrolase
242 381 Gene3D G3DSA:1.10.530.10 -
229 389 SMART SM00047 Lysozyme_4
229 389 InterPro IPR002901 Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase-like domain
56 107 Pfam PF10135 Rod binding protein
56 107 InterPro IPR019301 Flagellar protein FlgJ, N-terminal
113 160 MobiDBLite mobidb-lite consensus disorder prediction
33 390 PANTHER PTHR33308 PEPTIDOGLYCAN HYDROLASE FLGJ
208 229 MobiDBLite mobidb-lite consensus disorder prediction
19 385 NCBIfam TIGR02541 flagellar assembly peptidoglycan hydrolase FlgJ
19 385 InterPro IPR013377 Peptidoglycan hydrolase FlgJ
248 386 Pfam PF01832 Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
248 386 InterPro IPR002901 Mannosyl-glycoprotein endo-beta-N-acetylglucosamidase-like domain
204 279 SUPERFAMILY SSF53955 Lysozyme-like
204 279 InterPro IPR023346 Lysozyme-like domain superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1085
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
7 0.691
11 0.654
3 0.229