Protein profile

PA1093

hypothetical protein

Genome: NC_002516.2

Gene: PA1093 Structure source: AlphaFold UniProt Q9I4N7

Export view

Amino acids 123

Annotations 0

Features 9

PDB binders 0

Druggability 0.658

Overview

Basic information about this protein and its source genome.

Accession: PA1093
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: PA1093
Status: annotated
Amino acids: 123
Structure source: AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.658

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MDVGNITSLSTFKTGRAPEASGDIFAPRSAADGSGKPLPEVTASREASESRDDLGLAVSDIQSFVQSVKRNLNFSIDDSSGQVVVKVIDGDSGEVVRQIPSEEVLKLAARLDDVHSVLFETRA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

No GO or EC annotations are currently loaded for this protein.

Sequence Features

Domain/signature hits from InterPro and related databases.

9 records

Show feature table

Start	End	DB	Term	Name
34	118	Gene3D	G3DSA:3.30.160.170	-
34	118	InterPro	IPR035924	FlaG-like superfamily
20	49	MobiDBLite	mobidb-lite	consensus disorder prediction
43	120	Pfam	PF03646	FlaG protein
43	120	InterPro	IPR005186	FlaG protein
44	122	SUPERFAMILY	SSF160214	FlaG-like
44	122	InterPro	IPR035924	FlaG-like superfamily
1	123	PANTHER	PTHR37166	PROTEIN FLAG
1	123	InterPro	IPR005186	FlaG protein

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
AlphaFold PA1093	AlphaFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.658
1				0.306