Protein profile
PA1112a
hypothetical protein
Genome: NC_002516.2
Overview
Basic information about this protein and its source genome.
- Accession
- PA1112a
- Gene
- YP_008719740.1
- Status
- annotated
- Amino acids
- 73
- Structure source
- ColabFold
Target profile
Computed evidence for target prioritization.
- Human off-target
- No hit
- Gut microbiome off-target
- hit
- Essential (DEG)
- N
- Localization
- Unknown
Selected Druggability evidence
Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.
Sequence
Primary amino-acid sequence viewer.
MPGHPDPLHGVTLEKLLTELVAHHGWAELGKRVDIRCFRNDPSIKSSLAFLRKTPWAREKVEALYVQLKRNQG
Functional Annotations
Enzyme classification and Gene Ontology terms linked to this protein.
Gene Ontology (GO)
1- GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
Sequence Features
Domain/signature hits from InterPro and related databases.
Show feature table
| Start | End | DB | Term | Name |
|---|---|---|---|---|
| 12 | 71 | Gene3D | G3DSA:1.10.720.30 | SAP domain |
| 12 | 71 | InterPro | IPR036361 | SAP domain superfamily |
| 6 | 66 | Pfam | PF09905 | DNA-binding protein VF530 |
| 6 | 66 | InterPro | IPR018668 | DNA-binding protein VF530-like |
3D Structure
Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.
Loading 3D structure...
Structural evidence
0 + 1Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.
| Entry | Method | Resolution | Chain | Coverage | Links | Status |
|---|---|---|---|---|---|---|
|
ColabFold
PA1112A
|
ColabFold | — | — | full sequence | — | Viewing |
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer
Pockets (FPOCKET)
Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).
| FPOCKET | Sticks | Spheres | Surfaces | Druggability | Labels | Zoom | Positions |
|---|---|---|---|---|---|---|---|
| 2 | 0.663 | ||||||
| 1 | 0.541 |