Protein profile

PA1112a

hypothetical protein

Genome: NC_002516.2

Gene: YP_008719740.1 Structure source: ColabFold

Export view

Amino acids 73

Annotations 1

Features 4

PDB binders 0

Druggability 0.756

Overview

Basic information about this protein and its source genome.

Accession: PA1112a
Assembly: Pseudomonas aeruginosa PAO1, complete genome
Gene: YP_008719740.1
Status: annotated
Amino acids: 73
Structure source: ColabFold

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Target profile

Computed evidence for target prioritization.

Human off-target: No hit
Gut microbiome off-target: hit
Essential (DEG): N
Localization: Unknown

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.756

Structure –

Pocket –

Sequence

Primary amino-acid sequence viewer.

MPGHPDPLHGVTLEKLLTELVAHHGWAELGKRVDIRCFRNDPSIKSSLAFLRKTPWAREKVEALYVQLKRNQG

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

1 GO

Gene Ontology (GO)

GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).

Sequence Features

Domain/signature hits from InterPro and related databases.

4 records

Show feature table

Start	End	DB	Term	Name
12	71	Gene3D	G3DSA:1.10.720.30	SAP domain
12	71	InterPro	IPR036361	SAP domain superfamily
6	66	Pfam	PF09905	DNA-binding protein VF530
6	66	InterPro	IPR018668	DNA-binding protein VF530-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry	Method	Resolution	Chain	Coverage	Links	Status
ColabFold PA1112A	ColabFold	—	—	full sequence	—	Viewing

Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET	Sticks	Spheres	Surfaces	Druggability	Labels	Zoom	Positions
2				0.663
1				0.541