Protein profile

PA1135

molecular chaperone Hsp31/glyoxalase

Genome: NC_002516.2

Gene: hchA PA1135 Structure source: AlphaFold UniProt Q9I4K0
Amino acids 291
Annotations 10
Features 12
PDB binders 2
Druggability 0.673

Overview

Basic information about this protein and its source genome.

Accession
PA1135
Gene
hchA PA1135
Status
annotated
Amino acids
291
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.673
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MSNERDTSRTPTPDPAEHNAFFPSPYSLSQYTSAKTDFDGADYPTPYKGGKKVLMIGTDERYILMQNASMFSTGNHPVEMLLPMYHLDKAGFEFDVATLSGNPVKLEMWAMPGEDEAVKSIYAKYLPKLKAPRKLADLLEQAVADDSPYAAVFVPGGHGVLAGIPHSREVKRLLNAFLAKDRYIITLCHGPACLLAPAVEEKPEDYPFKGYEICVFPDALDTGANLEIGYMPGPLPWLVGENLQKLGVKILNKGITGQVHRDRKLLTGDSPLASNNLGKLAAKTLLEAFAR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 EC 7 GO

Enzyme Commission (EC)

3

Gene Ontology (GO)

7
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0019172 Catalysis of the reaction: methylglyoxal + H2O = D-lactate.
  • GO:0036524 Catalysis of the removal of a sugar or dicarbonyl from a glycated L-arginine, L-lysine or L-cysteine residue within proteins that have been attacked and modified by glyoxal or 2-oxopropanal.
  • GO:0016790 Catalysis of the reaction: RCO-SR' + H2O = RCOOH + HSR'. This reaction is the hydrolysis of a thiolester bond, an ester formed from a carboxylic acid and a thiol (i.e., RCO-SR'), such as that found in acetyl-coenzyme A.
  • GO:0006281 The process of restoring DNA after damage. Genomes are subject to damage by chemical and physical agents in the environment (e.g. UV and ionizing radiations, chemical mutagens, fungal and bacterial toxins, etc.) and by free radicals or alkylating agents endogenously generated in metabolism. DNA is also damaged because of errors during its replication. A variety of different DNA repair pathways have been reported that include direct reversal, base excision repair, nucleotide excision repair, photoreactivation, bypass, double-strand break repair pathway, and mismatch repair pathway.
  • GO:0019243 OBSOLETE. The chemical reactions and pathways resulting in the breakdown of methylglyoxal, CH3-CO-CHO, into pyruvate via the intermediate (R)-S-lactoyl-glutathione. Glutathione is used in the first step of the pathway and then regenerated in the second step.
  • GO:0030091 The process of restoring a protein to its original state after damage by such things as oxidation or spontaneous decomposition of residues.

Sequence Features

Domain/signature hits from InterPro and related databases.

12 records
Show feature table
Start End DB Term Name
1 21 MobiDBLite mobidb-lite consensus disorder prediction
3 291 Hamap MF_01046 Protein/nucleic acid deglycase HchA [hchA].
3 291 InterPro IPR017283 Protein/nucleic acid deglycase HchA
51 278 PANTHER PTHR48094 PROTEIN/NUCLEIC ACID DEGLYCASE DJ-1-RELATED
1 291 PIRSF PIRSF037798 Hsp31
1 291 InterPro IPR017283 Protein/nucleic acid deglycase HchA
2 290 Gene3D G3DSA:3.40.50.880 -
2 290 InterPro IPR029062 Class I glutamine amidotransferase-like
77 196 Pfam PF01965 DJ-1/PfpI family
77 196 InterPro IPR002818 DJ-1/PfpI
9 286 SUPERFAMILY SSF52317 Class I glutamine amidotransferase-like
9 286 InterPro IPR029062 Class I glutamine amidotransferase-like

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1135
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.673
5 0.34

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

2 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
GLV P64312 74.0 Da LogP -0.73 TPSA 54.4 ✓ Ro5 ✓ Clean C(=O)C(=O)O
LAC P64312 90.1 Da LogP -0.55 TPSA 57.5 ✓ Ro5 ✓ Clean C[C@H](C(=O)O)O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.