Protein profile

PA1137

oxidoreductase

Genome: NC_002516.2

Gene: PA1137 Structure source: AlphaFold UniProt Q9I4J8
Amino acids 328
Annotations 3
Features 16
PDB binders 14
Druggability 0.672

Overview

Basic information about this protein and its source genome.

Accession
PA1137
Gene
PA1137
Status
annotated
Amino acids
328
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
40.594
Human E-value
8.26e-45
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.672
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTAIEIARPGGPEVLVATSRPLPTPGPREVLVEVRAAGVNGPDVLQRKGVYDPPPGASDIPGLEIAGTVRAVGSEVSRFAVGEAVMALIPGGGYAQFAVADERTTLHLPDGLGMEEAAALPETFMTVWVNLFQRGGFKAGETLLVHGGASGIGTAATMLGKAFGAAKIFTTISSEAQREASLRLGADVAIDYTEQDFVEEVLRGTEGRGVDVIVDIVAGDYVTRNYQAAAMNGRIVQIGVIKGKAAEVDLFPMLSKRLVHLGSTLRSRSHDEKGAIIAELERQVWPHVRAGTVRPQVFRTFPLEQARQAHELMDSGQHIGKIVLTSAP

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0070402 Binding to the reduced form, NADPH, of nicotinamide-adenine dinucleotide phosphate, a coenzyme involved in many redox and biosynthetic reactions.
  • GO:0016651 Catalysis of an oxidation-reduction (redox) reaction in which NADH or NADPH acts as a hydrogen or electron donor and reduces a hydrogen or electron acceptor.
  • GO:0016491 Catalysis of an oxidation-reduction (redox) reaction, a reversible chemical reaction in which the oxidation state of an atom or atoms within a molecule is altered. One substrate acts as a hydrogen or electron donor and becomes oxidized, while the other acts as hydrogen or electron acceptor and becomes reduced.

Sequence Features

Domain/signature hits from InterPro and related databases.

16 records
Show feature table
Start End DB Term Name
1 325 NCBIfam TIGR02824 putative NAD(P)H quinone oxidoreductase, PIG3 family
1 325 InterPro IPR014189 Quinone oxidoreductase PIG3
111 288 SUPERFAMILY SSF51735 NAD(P)-binding Rossmann-fold domains
111 288 InterPro IPR036291 NAD(P)-binding domain superfamily
28 87 Pfam PF08240 Alcohol dehydrogenase GroES-like domain
28 87 InterPro IPR013154 Alcohol dehydrogenase-like, N-terminal
184 324 Pfam PF13602 Zinc-binding dehydrogenase
1 140 SUPERFAMILY SSF50129 GroES-like
1 140 InterPro IPR011032 GroES-like superfamily
1 325 PANTHER PTHR48106 QUINONE OXIDOREDUCTASE PIG3-RELATED
10 324 SMART SM00829 PKS_ER_names_mod
10 324 InterPro IPR020843 Polyketide synthase, enoylreductase domain
12 324 Gene3D G3DSA:3.90.180.10 -
1 324 CDD cd05276 p53_inducible_oxidoreductase
1 324 InterPro IPR014189 Quinone oxidoreductase PIG3
120 263 Gene3D G3DSA:3.40.50.720 -

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1137
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.672

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

164 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
1XX O23939 128.1 Da LogP 0.76 TPSA 46.5 ✓ Ro5 ✓ Clean C[C@@H]1C(=O)C(=C(O1)C)O
2XX O23939 142.2 Da LogP 1.15 TPSA 46.5 ✓ Ro5 ✓ Clean CC[C@@H]1C(=O)C(=C(O1)C)O
3XX O23939 140.1 Da LogP 1.28 TPSA 46.5 ✓ Ro5 ✓ Clean C/C=C/1\C(=O)C(=C(O1)C)O
4XX O23939 114.1 Da LogP 0.38 TPSA 46.5 ✓ Ro5 ✓ Clean CC1=C(C(=O)CO1)O
7FA P49327 344.5 Da LogP 7.38 TPSA 26.3 1 viol. ✓ Clean CCCCCC=CC/C=C\C/C=C\CCCCC[P@@](=O)(OC)F
CAC P49327 137.0 Da LogP -0.52 TPSA 40.1 ✓ Ro5 ✓ Clean C[As](=O)(C)[O-]
DH9 P49327 513.8 Da LogP 6.40 TPSA 112.9 2 viol. ✓ Clean CCCCCCCCCCC[C@@H](C[C@@H]([C@H](CCCCCC)C(=O)O)O…
DIF Q8N4Q0 296.2 Da LogP 4.36 TPSA 49.3 ✓ Ro5 ✓ Clean c1ccc(c(c1)CC(=O)O)Nc2c(cccc2Cl)Cl
DTT P49327 154.3 Da LogP -0.43 TPSA 40.5 ✓ Ro5 ✓ Clean C([C@@H]([C@H](CS)O)O)S
ETX P39462 90.1 Da LogP 0.02 TPSA 29.5 ✓ Ro5 ✓ Clean CCOCCO
KZH Q9SV68 292.4 Da LogP 4.84 TPSA 54.4 ✓ Ro5 ✓ Clean CCC=CCC(=O)C=CC=CCCCCCCCC(=O)O
TCL P49327 289.5 Da LogP 5.14 TPSA 29.5 1 viol. ✓ Clean c1cc(c(cc1Cl)O)Oc2ccc(cc2Cl)Cl
X1H Q8N4Q0 376.4 Da LogP 5.22 TPSA 66.8 1 viol. ✓ Clean COc1ccc(cc1)C(=O)c2c3ccc(cc3sc2c4ccc(cc4)O)O
ZEP P49327 404.5 Da LogP 4.57 TPSA 50.3 ✓ Ro5 ✓ Clean CCN(CC)S(=O)(=O)c1ccc(cc1)c2csc(n2)Cc3ccccc3F

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.