Protein profile

PA1142

transcriptional regulator

Genome: NC_002516.2

Gene: PA1142 Structure source: AlphaFold UniProt Q9I4J3
Amino acids 238
Annotations 4
Features 25
PDB binders 1
Druggability 0.697

Overview

Basic information about this protein and its source genome.

Accession
PA1142
Gene
PA1142
Status
annotated
Amino acids
238
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.697
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MRDEPSRPLTVIYQSLREQIERGLLARGSKLPSERQLSELFSTTRITLREALGQLEDQGLIYREERRGWFVSPQRLLYNPLVRSHFHAMVADQGRVPETEVLGAAMIPASVDICQRLELPALSRVFQIRRARRVDGRLVLYVEHYLNPAYFPGIERFDLTRSLTDLYANHYGIRYGRVRFEMVPTILPAEAAGPLRVSVGSPALQIVRVNRDQAGRLIDCDLEYWRHDALQVNVEVPE

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

4 GO

Gene Ontology (GO)

4
  • GO:0003677 Any molecular function by which a gene product interacts selectively and non-covalently with DNA (deoxyribonucleic acid).
  • GO:0003700 A transcription regulator activity that modulates transcription of gene sets via selective and non-covalent binding to a specific double-stranded genomic DNA sequence (sometimes referred to as a motif) within a cis-regulatory region. Regulatory regions include promoters (proximal and distal) and enhancers. Genes are transcriptional units, and include bacterial operons.
  • GO:0045892 Any process that stops, prevents, or reduces the frequency, rate or extent of cellular DNA-templated transcription.
  • GO:0006355 Any process that modulates the frequency, rate or extent of cellular DNA-templated transcription.

Sequence Features

Domain/signature hits from InterPro and related databases.

25 records
Show feature table
Start End DB Term Name
12 71 SMART SM00345 gntr3
12 71 InterPro IPR000524 Transcription regulator HTH, GntR
79 237 Gene3D G3DSA:3.40.1410.10 -
79 237 InterPro IPR028978 Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily
92 231 SMART SM00866 UTRA_2
92 231 InterPro IPR011663 UbiC transcription regulator-associated
3 74 Gene3D G3DSA:1.10.10.10 -
3 74 InterPro IPR036388 Winged helix-like DNA-binding domain superfamily
45 61 PRINTS PR00035 GntR bacterial regulatory protein HTH signature
45 61 InterPro IPR000524 Transcription regulator HTH, GntR
31 45 PRINTS PR00035 GntR bacterial regulatory protein HTH signature
31 45 InterPro IPR000524 Transcription regulator HTH, GntR
10 81 SUPERFAMILY SSF46785 Winged helix DNA-binding domain
10 81 InterPro IPR036390 Winged helix DNA-binding domain superfamily
6 74 ProSiteProfiles PS50949 GntR-type HTH domain profile.
6 74 InterPro IPR000524 Transcription regulator HTH, GntR
1 235 PANTHER PTHR44846 MANNOSYL-D-GLYCERATE TRANSPORT/METABOLISM SYSTEM REPRESSOR MNGR-RELATED
12 72 CDD cd07377 WHTH_GntR
12 72 InterPro IPR000524 Transcription regulator HTH, GntR
59 235 SUPERFAMILY SSF64288 Chorismate lyase-like
59 235 InterPro IPR028978 Chorismate pyruvate-lyase/UbiC transcription regulator-associated domain superfamily
12 71 Pfam PF00392 Bacterial regulatory proteins, gntR family
6 76 FunFam G3DSA:1.10.10.10:FF:000287 Phosphonate utilization transcriptional regulator PhnR
92 230 Pfam PF07702 UTRA domain
92 230 InterPro IPR011663 UbiC transcription regulator-associated

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1142
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.697

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

1 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
FLC A0A0H3LYW6 189.1 Da LogP -5.25 TPSA 140.6 ✓ Ro5 ✓ Clean C(C(=O)[O-])C(CC(=O)[O-])(C(=O)[O-])O

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.