Protein profile

PA1164

hypothetical protein

Genome: NC_002516.2

Gene: PA1164 Structure source: AlphaFold UniProt Q9I4H3
Amino acids 270
Annotations 5
Features 10
PDB binders 12
Druggability 0.679

Overview

Basic information about this protein and its source genome.

Accession
PA1164
Gene
PA1164
Status
annotated
Amino acids
270
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
34.211
Human E-value
3.34e-09
Gut microbiome off-target
hit
Essential (DEG)
Y
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.679
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MQVDEQRFGGIGRLYGREGLQRLADSHVAVVGIGGVGSWAAEALARSGVGEISLFDLDDVCVTNTNRQVHAIEGSVGKAKVEVMAARILAINPACRVHAVADFVTRETMAEYIVDFDYLIDCIDSVAAKAALIAWCKRRKIPVITTGGAGGQVDPTQIQVADLNKTFNDPLAAKVRSTLRRDYNFSRTPGRTYSVPCVFSSEQLRYPKPDGTVCQSKSFVGEGVKLDCAGGFGAVMMVTATFGMVAAARAVERLAEGRALRPSRRTPGNA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

5 GO

Gene Ontology (GO)

5
  • GO:0016020 A lipid bilayer along with all the proteins and protein complexes embedded in it and attached to it.
  • GO:0005524 Binding to ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.
  • GO:0061503 Catalysis of the ATP-dependent dehydration of t6A to form cyclic t6A.
  • GO:0008641 Catalysis of the activation of small proteins, such as ubiquitin or ubiquitin-like proteins, through the formation of an ATP-dependent high-energy thiolester bond.
  • GO:0061504 The chemical reactions and pathways resulting in the formation of cyclic threonylcarbamoyladenosine, a modified nucleoside found in some tRNA molecules.

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
1 262 FunFam G3DSA:3.40.50.720:FF:000096 tRNA cyclic N6-threonylcarbamoyladenosine(37) synthase TcdA
14 254 Pfam PF00899 ThiF family
14 254 InterPro IPR000594 THIF-type NAD/FAD binding fold
3 254 SUPERFAMILY SSF69572 Activating enzymes of the ubiquitin-like proteins
3 254 InterPro IPR035985 Ubiquitin-activating enzyme
15 251 CDD cd00755 YgdL_like
6 258 PANTHER PTHR43267 TRNA THREONYLCARBAMOYLADENOSINE DEHYDRATASE
6 258 InterPro IPR045886 ThiF/MoeB/HesA family
2 262 Gene3D G3DSA:3.40.50.720 -
229 251 TMHMM TMhelix Region of a membrane-bound protein predicted to be embedded in the membrane.

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1164
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.679

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

91 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
61T P22515 519.5 Da LogP 1.75 TPSA 152.1 1 viol. ✓ Clean c1cc(cc(c1)SC(F)(F)F)c2cc3nccc(n3n2)N[C@@H]4C[C…
6O2 P22515 446.4 Da LogP -0.61 TPSA 174.7 1 viol. ✓ Clean C#Cc1cccc(c1)Nc2c3c(ncn2)n(cn3)C4C(C(C(O4)COS(=…
8E7 O94609 217.4 Da LogP 3.65 TPSA 12.0 ✓ Ro5 ✓ Clean CCCCCCCCCCNCCS
8EA O94609 374.1 Da LogP 6.95 TPSA 12.0 1 viol. ✓ Clean CCCCCCCCCCNCCSSCc1ccc(cc1)Cl
APC Q47506 505.2 Da LogP -1.52 TPSA 269.9 3 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
B39 P22515 443.5 Da LogP 2.06 TPSA 132.4 ✓ Ro5 ✓ Clean c1ccc2c(c1)CC[C@@H]2Nc3c4ccn(c4ncn3)[C@@H]5C[C@…
FHJ Q9UBT2 421.5 Da LogP 3.30 TPSA 73.9 ✓ Ro5 ✓ Clean Cc1ccc(cc1)C[C@@H]([C@@]23C=C[C@@H](O2)[C@@H]([…
JZU O94609 345.3 Da LogP -3.18 TPSA 191.5 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
ND7 Q47506 346.2 Da LogP -1.90 TPSA 191.9 ✓ Ro5 ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
PG0 O94609 120.1 Da LogP -0.36 TPSA 38.7 ✓ Ro5 ✓ Clean COCCOCCO
POP P22314 176.0 Da LogP -2.08 TPSA 129.9 ✓ Ro5 ✓ Clean O[P@@](=O)([O-])O[P@@](=O)(O)[O-]
VMX O94609 387.4 Da LogP -2.70 TPSA 191.5 1 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.