Protein profile

PA1176

ferredoxin protein NapF

Genome: NC_002516.2

Gene: napF PA1176 Structure source: AlphaFold UniProt Q9I4G1
Export view
Amino acids 163
Annotations 3
Features 23
PDB binders 0
Druggability 0.683

Overview

Basic information about this protein and its source genome.

Accession
PA1176
Assembly
Pseudomonas aeruginosa PAO1, complete genome
Gene
napF PA1176
Status
annotated
Amino acids
163
Structure source
AlphaFold
GO
GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures. GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands. GO:0046872 Binding to a metal ion.

Target profile

Computed evidence for target prioritization.

Human off-target
No hit
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.683
Structure –
Pocket –

Sequence

Primary amino-acid sequence viewer.

MSSRRELFRRLGGHPPTRRPPWTAADFAAGCTGCAACVGACPEGVLKLGAGRLVELDLSSAGCTLCGECASRCEAGLFDGARPAFPWIATIGEACLALAGIHCRSCQDACEPAAIRFRPAPGGVALAELDSQRCNGCGACLAPCPSQAIQLRALSTKESPRHA

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0005737 The contents of a cell excluding the plasma membrane and nucleus, but including other subcellular structures.
  • GO:0051539 Binding to a 4 iron, 4 sulfur (4Fe-4S) cluster; this cluster consists of four iron atoms, with the inorganic sulfur atoms found between the irons and acting as bridging ligands.
  • GO:0046872 Binding to a metal ion.

Sequence Features

Domain/signature hits from InterPro and related databases.

23 records
Show feature table
Start End DB Term Name
28 151 SUPERFAMILY SSF54862 4Fe-4S ferredoxins
20 51 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
20 51 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
125 154 ProSiteProfiles PS51379 4Fe-4S ferredoxin-type iron-sulfur binding domain profile.
125 154 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
88 157 FunFam G3DSA:3.30.70.20:FF:000025 Ferredoxin-type protein NapF
90 161 Gene3D G3DSA:3.30.70.20 -
27 78 Gene3D G3DSA:3.30.70.20 -
18 154 CDD cd10564 NapF_like
18 154 InterPro IPR004496 Ferredoxin-type protein NapF
134 145 ProSitePatterns PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.
134 145 InterPro IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
101 148 Pfam PF12838 4Fe-4S dicluster domain
101 148 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
31 76 Pfam PF12838 4Fe-4S dicluster domain
31 76 InterPro IPR017896 4Fe-4S ferredoxin-type, iron-sulphur binding domain
21 155 Hamap MF_02201 Ferredoxin-type protein NapF [napF].
21 155 InterPro IPR004496 Ferredoxin-type protein NapF
31 42 ProSitePatterns PS00198 4Fe-4S ferredoxin-type iron-sulfur binding region signature.
31 42 InterPro IPR017900 4Fe-4S ferredoxin, iron-sulphur binding, conserved site
18 149 NCBIfam TIGR00402 ferredoxin-type protein NapF
18 149 InterPro IPR004496 Ferredoxin-type protein NapF
61 121 PANTHER PTHR43687 ADENYLYLSULFATE REDUCTASE, BETA SUBUNIT

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1176
AlphaFold — — full sequence — Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
3 0.683
1 0.639
2 0.431