Protein profile

PA1200

hypothetical protein

Genome: NC_002516.2

Gene: PA1200 Structure source: AlphaFold UniProt Q9I4D8
Amino acids 220
Annotations 3
Features 10
PDB binders 12
Druggability 0.599

Overview

Basic information about this protein and its source genome.

Accession
PA1200
Gene
PA1200
Status
annotated
Amino acids
220
Structure source
AlphaFold

Target profile

Computed evidence for target prioritization.

Human off-target
hit
Human identity (%)
46.243
Human E-value
1e-38
Gut microbiome off-target
hit
Essential (DEG)
N
Localization
Cytoplasmic

Selected Druggability evidence

Selected Druggability is the FPocket score chosen for ranking using the curated structure priority. The 3D viewer may show a different loaded structure, so its visible pockets can differ.

FPocket 0.599
Structure
Pocket

Sequence

Primary amino-acid sequence viewer.

MTTRTLNLDDNLYRYLLDVSLRETPLMTRLREETAKLPNARWQIAPEQGQFIALLLTLIGARRALEVGTFTGYSALCMATALGEQGRLTCCDLPGDYHLTARRYWREAAVEERIELRLGPALETLRALLDEGLAGQFDLAFIDADKANYPEYLEAALALVRQGGLVLFDNVLWSGRVLEAQPKSADTRGIQQLNLALKNDARVDYSLLPIGDGLSVCRKR

Functional Annotations

Enzyme classification and Gene Ontology terms linked to this protein.

3 GO

Gene Ontology (GO)

3
  • GO:0008171 Catalysis of the transfer of a methyl group to the oxygen atom of an acceptor molecule.
  • GO:0008757 Catalysis of the transfer of a methyl group from S-adenosyl-L-methionine to a substrate.
  • GO:0032259 The process in which a methyl group is covalently attached to a molecule.

Sequence Features

Domain/signature hits from InterPro and related databases.

10 records
Show feature table
Start End DB Term Name
3 220 ProSiteProfiles PS51682 SAM-dependent O-methyltransferase class I-type profile.
3 220 InterPro IPR002935 Class I-like SAM-dependent O-methyltransferase
4 219 PANTHER PTHR10509 O-METHYLTRANSFERASE-RELATED
19 219 Pfam PF01596 O-methyltransferase
19 219 InterPro IPR002935 Class I-like SAM-dependent O-methyltransferase
8 220 SUPERFAMILY SSF53335 S-adenosyl-L-methionine-dependent methyltransferases
8 220 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily
63 168 CDD cd02440 AdoMet_MTases
1 220 Gene3D G3DSA:3.40.50.150 Vaccinia Virus protein VP39
1 220 InterPro IPR029063 S-adenosyl-L-methionine-dependent methyltransferase superfamily

3D Structure

Selected loaded structure. Experimental PDB entries may cover only a portion of the sequence; predicted models typically cover the full protein.

3D visualization script Full viewer

Loading 3D structure...

Legend High Medium Low

Structural evidence

0 + 1

Experimental PDB entries and predicted models. Click Switch to display a different structure in the viewer.

Entry Method Resolution Chain Coverage Links Status
AlphaFold PA1200
AlphaFold full sequence Viewing
Pocket details FPocket · P2Rank — toggle visibility and zoom from here, or open full viewer

Pockets (FPOCKET)

Showing top-ranked FPocket candidates by druggability. Druggability is color-coded: high (0.7 or higher), medium (0.4 to 0.69), low (below 0.4).

FPOCKET Sticks Spheres Surfaces Druggability Labels Zoom Positions
1 0.599
2 0.53

Ligand evidence

Ligands grouped by evidence source. PDB ligands keep the source crystal visible, and loaded crystals can be opened directly in the structure viewer.

62 records

Structural evidence inferred from similar proteins. The source crystal indicates where the ligand was observed; the UniProt column identifies the homologous protein carrying that ligand.

Show only:
Ligand Source crystal UniProt (homolog) MW · LogP · TPSA Lipinski PAINS SMILES
4FE Q55813 194.2 Da LogP 1.50 TPSA 66.8 ✓ Ro5 ✓ Clean COc1ccc(cc1O)\C=C\C(=O)O
BU3 Q50859 90.1 Da LogP -0.25 TPSA 40.5 ✓ Ro5 ✓ Clean C[C@H]([C@@H](C)O)O
DNC P21964-2 200.1 Da LogP 0.91 TPSA 126.7 ✓ Ro5 Alert c1c(cc(c(c1[N+](=O)[O-])O)O)[N+](=O)[O-]
EAO P22734-2 265.2 Da LogP 1.57 TPSA 117.7 ✓ Ro5 Alert CC(=O)C(=Cc1cc(c(c(c1)O)O)[N+](=O)[O-])C(=O)C
FBN P22734-2 528.4 Da LogP -1.43 TPSA 262.7 3 viol. Alert c1c(cc(c(c1C(=O)NCc2cn(nn2)C[C@@H]3[C@H]([C@H](…
FER Q55813 194.2 Da LogP 1.50 TPSA 66.8 ✓ Ro5 ✓ Clean COc1cc(ccc1O)\C=C\C(=O)O
FGQ P22734-2 317.3 Da LogP 3.22 TPSA 67.3 ✓ Ro5 ✓ Clean Cc1ccc(cc1)S(=O)(=O)c2cc(c(c3c2cccn3)O)F
FRE Q40313 959.7 Da LogP -0.20 TPSA 413.3 3 viol. Alert CC(C)(CO[P@@](=O)(O)O[P@@](=O)(O)OC[C@@H]1[C@H]…
KOM P22734-2 254.2 Da LogP 2.87 TPSA 70.7 ✓ Ro5 Alert c1ccc(cc1)C2=CC(=O)Oc3c2ccc(c3O)O
LDP Q50859 153.2 Da LogP 0.60 TPSA 66.5 ✓ Ro5 Alert c1cc(c(cc1CCN)O)O
SFG P21964-2 381.4 Da LogP -2.06 TPSA 208.7 2 viol. ✓ Clean c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)…
SPF Q40313 971.7 Da LogP -0.15 TPSA 402.3 3 viol. ✓ Clean CC1([C@H](C1(C(=O)NCCC(=O)NCCSC(=O)\C=C\c2cc(c(…

PDB and ChEMBL records on this protein are shown in full. ChEMBL records from similar proteins are capped at the top 100 per protein (by pchembl) and ZINC at the top 50 (Tanimoto ≥ 0.5). ADME columns are descriptor-based screening flags, not experimental toxicity results.